Recombinant Human HAPLN2 protein, His-tagged
Cat.No. : | HAPLN2-2227H |
Product Overview : | Recombinant Human HAPLN2 protein(Q9GZV7)(27-340aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 27-340aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.2 kDa |
AA Sequence : | DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HAPLN2 hyaluronan and proteoglycan link protein 2 [ Homo sapiens ] |
Official Symbol | HAPLN2 |
Synonyms | BRAL1 |
Gene ID | 60484 |
mRNA Refseq | NM_021817.2 |
Protein Refseq | NP_068589.1 |
UniProt ID | Q9GZV7 |
◆ Recombinant Proteins | ||
HAPLN2-4575H | Recombinant Human HAPLN2 Protein, GST-tagged | +Inquiry |
HAPLN2-2035R | Recombinant Rhesus monkey HAPLN2 Protein, His-tagged | +Inquiry |
HAPLN2-2790R | Recombinant Rat HAPLN2 Protein | +Inquiry |
HAPLN2-2444R | Recombinant Rat HAPLN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HAPLN2-1856R | Recombinant Rhesus Macaque HAPLN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAPLN2 Products
Required fields are marked with *
My Review for All HAPLN2 Products
Required fields are marked with *