Recombinant Human HAPLN4 protein, GST-tagged
| Cat.No. : | HAPLN4-13668H |
| Product Overview : | Recombinant Human HAPLN4 protein(30-206 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 30-206 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHAAWRDGL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HAPLN4 hyaluronan and proteoglycan link protein 4 [ Homo sapiens ] |
| Official Symbol | HAPLN4 |
| Synonyms | HAPLN4; hyaluronan and proteoglycan link protein 4; BRAL2; KIAA1926; brain link protein 2; |
| Gene ID | 404037 |
| mRNA Refseq | NM_023002 |
| Protein Refseq | NP_075378 |
| UniProt ID | Q86UW8 |
| ◆ Recombinant Proteins | ||
| HAPLN4-30131H | Recombinant Human HAPLN4 protein, GST-tagged | +Inquiry |
| HAPLN4-3017H | Recombinant Human HAPLN4 protein, His-tagged | +Inquiry |
| HAPLN4-7481M | Recombinant Mouse HAPLN4 Protein | +Inquiry |
| HAPLN4-4012Z | Recombinant Zebrafish HAPLN4 | +Inquiry |
| HAPLN4-4578H | Recombinant Human HAPLN4 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAPLN4 Products
Required fields are marked with *
My Review for All HAPLN4 Products
Required fields are marked with *
