Recombinant Human HARBI1 protein, GST-tagged
Cat.No. : | HARBI1-5333H |
Product Overview : | Recombinant Human HARBI1 protein(1-349 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-349 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | HARBI1 harbinger transposase derived 1 [ Homo sapiens ] |
Official Symbol | HARBI1 |
Synonyms | HARBI1; harbinger transposase derived 1; C11orf77, chromosome 11 open reading frame 77; putative nuclease HARBI1; FLJ32675; harbinger transposase-derived nuclease; C11orf77; |
Gene ID | 283254 |
mRNA Refseq | NM_173811 |
Protein Refseq | NP_776172 |
UniProt ID | Q96MB7 |
◆ Recombinant Proteins | ||
HARBI1-2791R | Recombinant Rat HARBI1 Protein | +Inquiry |
HARBI1-1076Z | Recombinant Zebrafish HARBI1 | +Inquiry |
HARBI1-4579H | Recombinant Human HARBI1 Protein, GST-tagged | +Inquiry |
HARBI1-2036R | Recombinant Rhesus monkey HARBI1 Protein, His-tagged | +Inquiry |
HARBI1-2445R | Recombinant Rat HARBI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HARBI1-5635HCL | Recombinant Human HARBI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HARBI1 Products
Required fields are marked with *
My Review for All HARBI1 Products
Required fields are marked with *
0
Inquiry Basket