Recombinant Human HARS protein, His-tagged
Cat.No. : | HARS-3449H |
Product Overview : | Recombinant Human HARS protein(1-282 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-282 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAERAALEELVKLQGERVRGLKQQKASAELIEEEVAKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAGNFDPMIPDAECLKIMCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HARS histidyl-tRNA synthetase [ Homo sapiens ] |
Official Symbol | HARS |
Synonyms | HARS; histidyl-tRNA synthetase; histidine--tRNA ligase, cytoplasmic; histidine tRNA ligase 1; cytoplasmic; HisRS; histidine translase; HRS; USH3B; FLJ20491; |
Gene ID | 3035 |
mRNA Refseq | NM_001258040 |
Protein Refseq | NP_001244969 |
MIM | 142810 |
UniProt ID | P12081 |
◆ Recombinant Proteins | ||
HARS-13669H | Recombinant Human HARS, GST-tagged | +Inquiry |
HARS-7483M | Recombinant Mouse HARS Protein | +Inquiry |
HARS-8209H | Recombinant Human HARS protein, His-tagged | +Inquiry |
HARS-369H | Recombinant Human Histidyl-tRNA Synthetase, His-tagged | +Inquiry |
HARS-793H | Recombinant Human Histidyl-tRNA Synthetase, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HARS-770HCL | Recombinant Human HARS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HARS Products
Required fields are marked with *
My Review for All HARS Products
Required fields are marked with *