Recombinant Human HAUS1, His-tagged
Cat.No. : | HAUS1-26321TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-278 of Human CCDC5 with N terminal His tag, 34kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-278 a.a. |
Description : | HAUS1 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb augmentare, meaning to increase. The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al. |
Conjugation : | HIS |
Tissue specificity : | Widely expressed. Expressed in pancreas, kidney, skeletal muscle, liver and heart. Weakly expressed in lung, brain and placenta. |
Form : | Lyophilised:Reconstitute with 63 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHL SERNRVRDRDVYLVIEDLKQKASEYESEAKYLQDLLME SVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPA VNDLTSDLFRTKSKSEEIKIELEKLEKNLTATLVLEKC LQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRF GIKAAEEQLSARGMDASLSHQSLVALSEKLARLKQQTIPL KKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRR VDMMEL |
Sequence Similarities : | Belongs to the HAUS1 family. |
Full Length : | Full L. |
Gene Name | HAUS1 HAUS augmin-like complex, subunit 1 [ Homo sapiens ] |
Official Symbol | HAUS1 |
Synonyms | HAUS1; HAUS augmin-like complex, subunit 1; CCDC5, coiled coil domain containing 5 (spindle associated); HAUS augmin-like complex subunit 1; FLJ40084; HEI C; HsT1461; |
Gene ID | 115106 |
mRNA Refseq | NM_138443 |
Protein Refseq | NP_612452 |
MIM | 608775 |
Uniprot ID | Q96CS2 |
Chromosome Location | 18q21.1 |
Function | molecular_function; |
◆ Recombinant Proteins | ||
HAUS1-5580H | Recombinant Human HAUS Augmin-like Complex, Subunit 1, His-tagged | +Inquiry |
HAUS1-4063M | Recombinant Mouse HAUS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HAUS1-15831H | Recombinant Human HAUS1, His-tagged | +Inquiry |
HAUS1-3097H | Recombinant Human HAUS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HAUS1-2956H | Recombinant Human HAUS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAUS1-5630HCL | Recombinant Human HAUS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAUS1 Products
Required fields are marked with *
My Review for All HAUS1 Products
Required fields are marked with *