"HAVCR2" Related Products

Expand
Expand

Recombinant Human HAVCR2 protein, T7/His-tagged

Cat.No.: HAVCR2-175H
Product Overview: Recombinant human TIM3 cDNA (22 – 202 aa, derived from BC063431) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVV LRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTRQR DFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRIG
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: HAVCR2 hepatitis A virus cellular receptor 2 [ Homo sapiens ]
Official Symbol: HAVCR2
Synonyms: HAVCR2; Tim 3; TIM3; TIMD3; kidney injury molecule-3; T-cell membrane protein 3; T cell immunoglobulin mucin 3; KIM-3; Tim-3; TIMD-3; HAVcr-2;
Gene ID: 84868
mRNA Refseq: NM_032782
Protein Refseq: NP_116171
MIM: 606652
UniProt ID: Q8TDQ0
Chromosome Location: 5q34

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.