Recombinant Human HAX1, His-tagged
Cat.No. : | HAX1-29183TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 65-231 of Human HAX1 Isoform 5 with N terminal His tag; MWt 22 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 65-231 a.a. |
Description : | The protein encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 98 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSE SPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQ VSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRT VVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR |
Gene Name | HAX1 HCLS1 associated protein X-1 [ Homo sapiens ] |
Official Symbol | HAX1 |
Synonyms | HAX1; HCLS1 associated protein X-1; HCLS1-associated protein X-1; HCLS1 (and PKD2) associated protein; HCLSBP1; HS1BP1; |
Gene ID | 10456 |
mRNA Refseq | NM_001018837 |
Protein Refseq | NP_001018238 |
MIM | 605998 |
Uniprot ID | O00165 |
Chromosome Location | 1q21.3 |
Function | interleukin-1 binding; protein N-terminus binding; protein binding; |
◆ Recombinant Proteins | ||
HAX1-2039R | Recombinant Rhesus monkey HAX1 Protein, His-tagged | +Inquiry |
HAX1-486Z | Recombinant Zebrafish HAX1 | +Inquiry |
HAX1-7525H | Recombinant Human HAX1, His-tagged | +Inquiry |
HAX1-4592H | Recombinant Human HAX1 Protein, GST-tagged | +Inquiry |
HAX1-3489HF | Recombinant Full Length Human HAX1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAX1-5626HCL | Recombinant Human HAX1 293 Cell Lysate | +Inquiry |
HAX1-5625HCL | Recombinant Human HAX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAX1 Products
Required fields are marked with *
My Review for All HAX1 Products
Required fields are marked with *