Recombinant Human HAX1, His-tagged

Cat.No. : HAX1-29183TH
Product Overview : Recombinant fragment, corresponding to amino acids 65-231 of Human HAX1 Isoform 5 with N terminal His tag; MWt 22 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 65-231 a.a.
Description : The protein encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 98 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSE SPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQ VSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRT VVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR
Gene Name HAX1 HCLS1 associated protein X-1 [ Homo sapiens ]
Official Symbol HAX1
Synonyms HAX1; HCLS1 associated protein X-1; HCLS1-associated protein X-1; HCLS1 (and PKD2) associated protein; HCLSBP1; HS1BP1;
Gene ID 10456
mRNA Refseq NM_001018837
Protein Refseq NP_001018238
MIM 605998
Uniprot ID O00165
Chromosome Location 1q21.3
Function interleukin-1 binding; protein N-terminus binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HAX1 Products

Required fields are marked with *

My Review for All HAX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon