Recombinant Human HBA1 Protein, GST-tagged
| Cat.No. : | HBA1-4594H |
| Product Overview : | Human HBA1 partial ORF ( NP_000549, 33 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5 untranslated regions and the introns, but they differ significantly over the 3 untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported. [provided by RefSeq |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HBA1 hemoglobin, alpha 1 [ Homo sapiens ] |
| Official Symbol | HBA1 |
| Synonyms | HBA1; hemoglobin, alpha 1; hemoglobin subunit alpha; alpha-globin; alpha-1 globin; alpha-1-globin; alpha one globin; hemoglobin alpha chain; hemoglobin alpha-1 chain; hemoglobin alpha 1 globin chain; HBH; CD31; MGC126895; MGC126897; |
| Gene ID | 3039 |
| mRNA Refseq | NM_000558 |
| Protein Refseq | NP_000549 |
| UniProt ID | P69905 |
| ◆ Recombinant Proteins | ||
| HBA1-2450H | Recombinant Human HBA1 Protein (Met1-Arg142), His tagged | +Inquiry |
| CPBTT-30937GH | Goat Anti-Human Hemoglobin PAb, HRP-Conjugation | +Inquiry |
| HBA1-13678H | Recombinant Human HBA1, GST-tagged | +Inquiry |
| HBA1-4594H | Recombinant Human HBA1 Protein, GST-tagged | +Inquiry |
| HBA1-7859H | Recombinant Human HBA1 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| HBA1-5284H | Native Human Hemoglobin, Alpha 1 | +Inquiry |
| HBA1-8158H | Native Hemoglobin A1C (HbA1c) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HBA1-5624HCL | Recombinant Human HBA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBA1 Products
Required fields are marked with *
My Review for All HBA1 Products
Required fields are marked with *
