Recombinant Human HBA2 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | HBA2-098H |
Product Overview : | HBA2 MS Standard C13 and N15-labeled recombinant protein (NP_000508) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported. |
Molecular Mass : | 15.3 kDa |
AA Sequence : | MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HBA2 hemoglobin subunit alpha 2 [ Homo sapiens (human) ] |
Official Symbol | HBA2 |
Synonyms | HBA2 hemoglobin subunit alpha 2; HBH; ECYT7; HBA-T2; hemoglobin subunit alpha; alpha globin; alpha-2 globin; hemoglobin alpha chain; hemoglobin, alpha 2; mutant hemoglobin alpha 2 globin chain; truncated HbA2 |
Gene ID | 3040 |
mRNA Refseq | NM_000517 |
Protein Refseq | NP_000508 |
MIM | 141850 |
UniProt ID | P69905 |
◆ Recombinant Proteins | ||
HBA2-856HFL | Recombinant Full Length Human HBA2 Protein, C-Flag-tagged | +Inquiry |
HBA2-098H | Recombinant Human HBA2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
HBA2-1063H | Recombinant Human HBA2 Protein, MYC/DDK-tagged | +Inquiry |
HBA2-29306TH | Recombinant Human HBA2 | +Inquiry |
HBA2-43H | Recombinant Human HBA2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HBA2-27784TH | Native Human HBA2 | +Inquiry |
HBA2-27786TH | Native Human HBA2 | +Inquiry |
HBA2-27787TH | Native Human HBA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBA2-5623HCL | Recombinant Human HBA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HBA2 Products
Required fields are marked with *
My Review for All HBA2 Products
Required fields are marked with *
0
Inquiry Basket