Recombinant Human HBE1 Protein, GST-tagged

Cat.No. : HBE1-4598H
Product Overview : Human HBE1 full-length ORF ( AAH15537, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The epsilon globin gene (HBE) is normally expressed in the embryonic yolk sac: two epsilon chains together with two zeta chains (an alpha-like globin) constitute the embryonic hemoglobin Hb Gower I; two epsilon chains together with two alpha chains form the embryonic Hb Gower II. Both of these embryonic hemoglobins are normally supplanted by fetal, and later, adult hemoglobin. The five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in the following order: 5-epsilon - G-gamma - A-gamma - delta - beta-3 [provided by RefSeq
Molecular Mass : 41.69 kDa
AA Sequence : MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HBE1 hemoglobin subunit epsilon 1 [ Homo sapiens (human) ]
Official Symbol HBE1
Synonyms HBE1; hemoglobin subunit epsilon 1; HBE; hemoglobin subunit epsilon; epsilon globin; hemoglobin epsilon chain; hemoglobin, epsilon 1
Gene ID 3046
mRNA Refseq NM_005330
Protein Refseq NP_005321
MIM 142100
UniProt ID P02100

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HBE1 Products

Required fields are marked with *

My Review for All HBE1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon