Recombinant Human HBE1 Protein, GST-tagged
| Cat.No. : | HBE1-4598H |
| Product Overview : | Human HBE1 full-length ORF ( AAH15537, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The epsilon globin gene (HBE) is normally expressed in the embryonic yolk sac: two epsilon chains together with two zeta chains (an alpha-like globin) constitute the embryonic hemoglobin Hb Gower I; two epsilon chains together with two alpha chains form the embryonic Hb Gower II. Both of these embryonic hemoglobins are normally supplanted by fetal, and later, adult hemoglobin. The five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in the following order: 5-epsilon - G-gamma - A-gamma - delta - beta-3 [provided by RefSeq |
| Molecular Mass : | 41.69 kDa |
| AA Sequence : | MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HBE1 hemoglobin subunit epsilon 1 [ Homo sapiens (human) ] |
| Official Symbol | HBE1 |
| Synonyms | HBE1; hemoglobin subunit epsilon 1; HBE; hemoglobin subunit epsilon; epsilon globin; hemoglobin epsilon chain; hemoglobin, epsilon 1 |
| Gene ID | 3046 |
| mRNA Refseq | NM_005330 |
| Protein Refseq | NP_005321 |
| MIM | 142100 |
| UniProt ID | P02100 |
| ◆ Recombinant Proteins | ||
| HBE1-1618H | Recombinant Human HBE1 Protein, His&GST-tagged | +Inquiry |
| HBE1-4598H | Recombinant Human HBE1 Protein, GST-tagged | +Inquiry |
| HBE1-3492HF | Recombinant Full Length Human HBE1 Protein, GST-tagged | +Inquiry |
| HBE1-1062H | Recombinant Human HBE1 Protein, MYC/DDK-tagged | +Inquiry |
| HBE1-3136C | Recombinant Chicken HBE1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HBE1-316HCL | Recombinant Human HBE1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBE1 Products
Required fields are marked with *
My Review for All HBE1 Products
Required fields are marked with *
