Recombinant Human HBEGF protein
Cat.No. : | HBEGF-530H |
Product Overview : | Recombinant Human HBEGF protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 86 |
Description : | Heparin-binding epidermal growth factor (HB-EGF)-like growth factor (EGF) is found in cerebral neurons. Its expression is increased after hypoxic or ischemic injury, which also stimulates neurogenesis. HB-EGF has been implicated as a participant in a variety of normal physiological processes such as blastocyst implantation, wound healing, and in pathological processes such as tumor growth, SMC hyperplasia and atherosclerosis. HB-EGF is an 87 amino acid mitogenic and chemotactic glycoprotein containing an EGF-like domain with six conserved cysteine residues. Human HB-EGF shares about 73 % and 76 % a.a. sequence identity with murine and rat HB-EGF. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 9.7 kDa, a single non-glycosylated polypeptide chain containing 86 amino acids. |
AA Sequence : | DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL |
Endotoxin : | Less than 1 EU/μg of rHuHB-EGF as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | HBEGF |
Official Symbol | HBEGF |
Synonyms | HBEGF; heparin-binding EGF-like growth factor; diphtheria toxin receptor (heparin binding epidermal growth factor like growth factor) , DTR, DTS, HEGFL; proheparin-binding EGF-like growth factor; Diphtheria toxin receptor (heparin binding EGF like growth factor); heparin binding epidermal growth factor; heparin-binding epidermal growth factor; diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); DTR; DTS; DTSF; HEGFL; |
Gene ID | 1839 |
mRNA Refseq | NM_001945 |
Protein Refseq | NP_001936 |
MIM | 126150 |
UniProt ID | Q99075 |
◆ Recombinant Proteins | ||
HBEGF-871H | Active Recombinant Human HBEGF | +Inquiry |
HBEGF-8325H | Active Recombinant Human HBEGF | +Inquiry |
HBEGF-385H | Active Recombinant Human HBEGF Protein (86 aa) | +Inquiry |
HBEGF-056H | Active Recombinant Human HBEGF Protein | +Inquiry |
HBEGF-2455R | Recombinant Rat HBEGF Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBEGF-551HCL | Recombinant Human HBEGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBEGF Products
Required fields are marked with *
My Review for All HBEGF Products
Required fields are marked with *
0
Inquiry Basket