Recombinant Human HBEGF protein, His-tagged

• Cat.No.: HBEGF-6733H
• Product Overview: Recombinant Human HBEGF protein(25-162 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 25-162 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: SLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTI
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: HBEGF heparin-binding EGF-like growth factor [ Homo sapiens ]
• Official Symbol: HBEGF
• Synonyms: HBEGF; heparin-binding EGF-like growth factor; diphtheria toxin receptor (heparin binding epidermal growth factor like growth factor) , DTR, DTS, HEGFL; proheparin-binding EGF-like growth factor; Diphtheria toxin receptor (heparin binding EGF like growth factor); heparin binding epidermal growth factor; heparin-binding epidermal growth factor; diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); DTR; DTS; DTSF; HEGFL
• Gene ID: 1839
• mRNA Refseq: NM_001945
• Protein Refseq: NP_001936
• MIM: 126150
• UniProt ID: Q99075