Recombinant Human HBEGF protein, His-tagged
| Cat.No. : | HBEGF-6733H |
| Product Overview : | Recombinant Human HBEGF protein(25-162 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 25-162 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | SLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HBEGF heparin-binding EGF-like growth factor [ Homo sapiens ] |
| Official Symbol | HBEGF |
| Synonyms | HBEGF; heparin-binding EGF-like growth factor; diphtheria toxin receptor (heparin binding epidermal growth factor like growth factor) , DTR, DTS, HEGFL; proheparin-binding EGF-like growth factor; Diphtheria toxin receptor (heparin binding EGF like growth factor); heparin binding epidermal growth factor; heparin-binding epidermal growth factor; diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); DTR; DTS; DTSF; HEGFL; |
| Gene ID | 1839 |
| mRNA Refseq | NM_001945 |
| Protein Refseq | NP_001936 |
| MIM | 126150 |
| UniProt ID | Q99075 |
| ◆ Recombinant Proteins | ||
| Hbegf-592R | Recombinant Rat Hbegf protein | +Inquiry |
| HBEGF-3493HF | Recombinant Full Length Human HBEGF Protein, GST-tagged | +Inquiry |
| HBEGF-4076M | Recombinant Mouse HBEGF Protein, His (Fc)-Avi-tagged | +Inquiry |
| HBEGF-339H | Recombinant Human Heparin-Binding EGF-Like Growth Factor | +Inquiry |
| HBEGF-1534H | Active Recombinant Human HBEGF protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HBEGF-551HCL | Recombinant Human HBEGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBEGF Products
Required fields are marked with *
My Review for All HBEGF Products
Required fields are marked with *
