Recombinant Human HBG2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HBG2-5619H
Product Overview : HBG2 MS Standard C13 and N15-labeled recombinant protein (NP_000175) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'- epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.
Molecular Mass : 16.1 kDa
AA Sequence : MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HBG2 hemoglobin subunit gamma 2 [ Homo sapiens (human) ]
Official Symbol HBG2
Synonyms HBG2; hemoglobin subunit gamma 2; TNCY; HBG-T1; hemoglobin subunit gamma-2; G-gamma globin Paulinia; abnormal hemoglobin; gamma globin; gamma-2-globin; gamma-globin chain; hb F Ggamma; hemoglobin gamma-2 chain; hemoglobin gamma-G chain; hemoglobin, gamma G; methemoglobin
Gene ID 3048
mRNA Refseq NM_000184
Protein Refseq NP_000175
MIM 142250
UniProt ID P69892

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HBG2 Products

Required fields are marked with *

My Review for All HBG2 Products

Required fields are marked with *

0
cart-icon