Recombinant Human HBM Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HBM-5219H
Product Overview : HBM MS Standard C13 and N15-labeled recombinant protein (NP_001003938) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. This gene has an ORF encoding a 141 aa polypeptide which is similar to the delta globins found in reptiles and birds. This locus was originally described as a pseudogene; however, it is currently thought to be a protein-coding gene.
Molecular Mass : 15.6 kDa
AA Sequence : MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQRMLAAVGAAVQHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQMQAAWDKFLTGVAVVLTEKYRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HBM hemoglobin subunit mu [ Homo sapiens (human) ]
Official Symbol HBM
Synonyms hemoglobin, mu; 4826; Ensembl:ENSG00000206177; hemoglobin subunit mu;mu-globin;hemoglobin mu chain;alpha globin pseudogene 2;hemoglobin, alpha pseudogene 2; HBAP2
Gene ID 3042
mRNA Refseq NM_001003938
Protein Refseq NP_001003938
MIM 609639
UniProt ID Q6B0K9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HBM Products

Required fields are marked with *

My Review for All HBM Products

Required fields are marked with *

0
cart-icon
0
compare icon