Recombinant Human HBM Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HBM-5219H |
Product Overview : | HBM MS Standard C13 and N15-labeled recombinant protein (NP_001003938) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. This gene has an ORF encoding a 141 aa polypeptide which is similar to the delta globins found in reptiles and birds. This locus was originally described as a pseudogene; however, it is currently thought to be a protein-coding gene. |
Molecular Mass : | 15.6 kDa |
AA Sequence : | MLSAQERAQIAQVWDLIAGHEAQFGAELLLRLFTVYPSTKVYFPHLSACQDATQLLSHGQRMLAAVGAAVQHVDNLRAALSPLADLHALVLRVDPANFPLLIQCFHVVLASHLQDEFTVQMQAAWDKFLTGVAVVLTEKYRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HBM hemoglobin subunit mu [ Homo sapiens (human) ] |
Official Symbol | HBM |
Synonyms | hemoglobin, mu; 4826; Ensembl:ENSG00000206177; hemoglobin subunit mu;mu-globin;hemoglobin mu chain;alpha globin pseudogene 2;hemoglobin, alpha pseudogene 2; HBAP2 |
Gene ID | 3042 |
mRNA Refseq | NM_001003938 |
Protein Refseq | NP_001003938 |
MIM | 609639 |
UniProt ID | Q6B0K9 |
◆ Recombinant Proteins | ||
HBM-5219H | Recombinant Human HBM Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HBM-1866R | Recombinant Rhesus Macaque HBM Protein, His (Fc)-Avi-tagged | +Inquiry |
HBM-13684H | Recombinant Human HBM, GST-tagged | +Inquiry |
HBM-2599H | Recombinant Human HBM Protein (Val13-Gln120), N-His tagged | +Inquiry |
HBM-7900H | Recombinant Human HBM protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBM-5618HCL | Recombinant Human HBM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBM Products
Required fields are marked with *
My Review for All HBM Products
Required fields are marked with *