Recombinant Human HBXIP protein, GST-tagged

Cat.No. : HBXIP-3022H
Product Overview : Recombinant Human HBXIP protein(O43504)(1-91aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-91aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.6 kDa
AA Sequence : MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name HBXIP hepatitis B virus x interacting protein [ Homo sapiens ]
Official Symbol HBXIP
Synonyms HBXIP; hepatitis B virus x interacting protein; hepatitis B virus X-interacting protein; HBx interacting protein; hepatitis B virus x interacting protein (9.6kD); MGC71071; XIP; HBx-interacting protein; HBV X-interacting protein; hepatitis B virus x-interacting protein (9.6kD);
Gene ID 10542
mRNA Refseq NM_006402
Protein Refseq NP_006393
MIM 608521
UniProt ID O43504

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HBXIP Products

Required fields are marked with *

My Review for All HBXIP Products

Required fields are marked with *

0
cart-icon
0
compare icon