Recombinant Human HBXIP protein, GST-tagged
Cat.No. : | HBXIP-3022H |
Product Overview : | Recombinant Human HBXIP protein(O43504)(1-91aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-91aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.6 kDa |
AA Sequence : | MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HBXIP hepatitis B virus x interacting protein [ Homo sapiens ] |
Official Symbol | HBXIP |
Synonyms | HBXIP; hepatitis B virus x interacting protein; hepatitis B virus X-interacting protein; HBx interacting protein; hepatitis B virus x interacting protein (9.6kD); MGC71071; XIP; HBx-interacting protein; HBV X-interacting protein; hepatitis B virus x-interacting protein (9.6kD); |
Gene ID | 10542 |
mRNA Refseq | NM_006402 |
Protein Refseq | NP_006393 |
MIM | 608521 |
UniProt ID | O43504 |
◆ Recombinant Proteins | ||
HBXIP-3022H | Recombinant Human HBXIP protein, GST-tagged | +Inquiry |
HBXIP-4063C | Recombinant Chicken HBXIP | +Inquiry |
HBXIP-13689H | Recombinant Human HBXIP protein, GST-tagged | +Inquiry |
HBXIP-6961H | Recombinant Human Hepatitis B Virus X Interacting Protein, His-tagged | +Inquiry |
HBXIP-3501HF | Recombinant Full Length Human HBXIP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBXIP-5616HCL | Recombinant Human HBXIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBXIP Products
Required fields are marked with *
My Review for All HBXIP Products
Required fields are marked with *
0
Inquiry Basket