Recombinant Human HCFC1
| Cat.No. : | HCFC1-29188TH |
| Product Overview : | Recombinant fragment of Human Host Cell Factor C1 with N-terminal proprietary tag. Predicted MW 35.20 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 87 amino acids |
| Description : | This gene is a member of the host cell factor family and encodes a protein with five Kelch repeats, a fibronectin-like motif, and six HCF repeats, each of which contains a highly specific cleavage signal. This nuclear coactivator is proteolytically cleaved at one of the six possible sites, resulting in the creation of an N-terminal chain and the corresponding C-terminal chain. The final form of this protein consists of noncovalently bound N- and C-terminal chains. The protein is involved in control of the cell cycle and transcriptional regulation during herpes simplex virus infection. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. |
| Molecular Weight : | 35.200kDa inclusive of tags |
| Tissue specificity : | Highly expressed in fetal tissues and the adult kidney. Present in all tissues tested. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | KSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGTILKLVTSADGKPTTIITTTQASGAGTKPTIL |
| Sequence Similarities : | Contains 5 Kelch repeats. |
| Gene Name | HCFC1 host cell factor C1 (VP16-accessory protein) [ Homo sapiens ] |
| Official Symbol | HCFC1 |
| Synonyms | HCFC1; host cell factor C1 (VP16-accessory protein); HFC1; host cell factor 1; CFF; HCF 1; HCF1; MGC70925; VCAF; |
| Gene ID | 3054 |
| mRNA Refseq | NM_005334 |
| Protein Refseq | NP_005325 |
| MIM | 300019 |
| Uniprot ID | P51610 |
| Chromosome Location | Xq28 |
| Pathway | Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Mitochondrial Gene Expression, organism-specific biosystem; |
| Function | chromatin binding; identical protein binding; protein binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; |
| ◆ Recombinant Proteins | ||
| HCFC1-29188TH | Recombinant Human HCFC1 | +Inquiry |
| HCFC1-4079M | Recombinant Mouse HCFC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HCFC1-13692H | Recombinant Human HCFC1, GST-tagged | +Inquiry |
| HCFC1-407H | Recombinant Human HCFC1 Protein, His-tagged | +Inquiry |
| HCFC1-4617H | Recombinant Human HCFC1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCFC1 Products
Required fields are marked with *
My Review for All HCFC1 Products
Required fields are marked with *
