Recombinant Human HCFC1R1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | HCFC1R1-1863H |
| Product Overview : | HCFC1R1 MS Standard C13 and N15-labeled recombinant protein (NP_060355) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus. |
| Molecular Mass : | 15.3 kDa |
| AA Sequence : | MILQQPLQRGPQGGAQRLPRAALGVTWGLDASSPLRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPMTFSPALPPLRSPCSELLLWRYPGSLIPEALRLLRLGDTPSPPYPATPAGDIMELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | HCFC1R1 host cell factor C1 regulator 1 [ Homo sapiens (human) ] |
| Official Symbol | HCFC1R1 |
| Synonyms | HCFC1R1; host cell factor C1 regulator 1 (XPO1 dependent); host cell factor C1 regulator 1 (XPO1 dependant); host cell factor C1 regulator 1; FLJ20568; HPIP; HCF-1 beta-propeller interacting protein; HCF-1 beta-propeller-interacting protein; MGC70711; MGC99622; |
| Gene ID | 54985 |
| mRNA Refseq | NM_017885 |
| Protein Refseq | NP_060355 |
| MIM | 618818 |
| UniProt ID | Q9NWW0 |
| ◆ Recombinant Proteins | ||
| HCFC1R1-2803R | Recombinant Rat HCFC1R1 Protein | +Inquiry |
| HCFC1R1-4080M | Recombinant Mouse HCFC1R1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HCFC1R1-513H | Recombinant Human HCFC1R1 Protein, His-tagged | +Inquiry |
| HCFC1R1-1869R | Recombinant Rhesus Macaque HCFC1R1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Hcfc1r1-3364M | Recombinant Mouse Hcfc1r1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HCFC1R1-5614HCL | Recombinant Human HCFC1R1 293 Cell Lysate | +Inquiry |
| HCFC1R1-5613HCL | Recombinant Human HCFC1R1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCFC1R1 Products
Required fields are marked with *
My Review for All HCFC1R1 Products
Required fields are marked with *
