Recombinant Human HCLS1
Cat.No. : | HCLS1-27262TH |
Product Overview : | Recombinant fragment of Human HCLS1 with N terminal proprietary tag. Predicted MW 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | Hematopoietic lineage cell-specific protein is a protein that in humans is encoded by the HCLS1 gene. |
Molecular Weight : | 35.530kDa inclusive of tags |
Tissue specificity : | Expressed only in tissues and cells of hematopoietic origin. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE |
Sequence Similarities : | Contains 4 cortactin repeats.Contains 1 SH3 domain. |
Gene Name | HCLS1 hematopoietic cell-specific Lyn substrate 1 [ Homo sapiens ] |
Official Symbol | HCLS1 |
Synonyms | HCLS1; hematopoietic cell-specific Lyn substrate 1; hematopoietic lineage cell-specific protein; cortactin like; CTTNL; HS1; |
Gene ID | 3059 |
mRNA Refseq | NM_005335 |
Protein Refseq | NP_005326 |
MIM | 601306 |
Uniprot ID | P14317 |
Chromosome Location | 3q13 |
Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem; IL-5 Signaling Pathway, organism-specific biosystem; |
Function | DNA binding; SH3 domain binding; protein complex binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
HCLS1-073H | Recombinant Human hematopoietic cell-specific Lyn substrate 1 Protein, His&StrepII tagged | +Inquiry |
HCLS1-223HF | Recombinant Full Length Human HCLS1 Protein | +Inquiry |
HCLS1-4086Z | Recombinant Zebrafish HCLS1 | +Inquiry |
HCLS1-001H | Recombinant Human HCLS1 Protein, His-tagged | +Inquiry |
HCLS1-27309TH | Recombinant Human HCLS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HCLS1-5611HCL | Recombinant Human HCLS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCLS1 Products
Required fields are marked with *
My Review for All HCLS1 Products
Required fields are marked with *