Recombinant Human HCLS1

• Cat.No.: HCLS1-27262TH
• Product Overview: Recombinant fragment of Human HCLS1 with N terminal proprietary tag. Predicted MW 35.53 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 90 amino acids
• Description: Hematopoietic lineage cell-specific protein is a protein that in humans is encoded by the HCLS1 gene.
• Molecular Weight: 35.530kDa inclusive of tags
• Tissue specificity: Expressed only in tissues and cells of hematopoietic origin.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
• Sequence Similarities: Contains 4 cortactin repeats.Contains 1 SH3 domain.

Gene Information

• Gene Name: HCLS1 hematopoietic cell-specific Lyn substrate 1 [ Homo sapiens ]
• Official Symbol: HCLS1
• Synonyms: HCLS1; hematopoietic cell-specific Lyn substrate 1; hematopoietic lineage cell-specific protein; cortactin like; CTTNL; HS1
• Gene ID: 3059
• mRNA Refseq: NM_005335
• Protein Refseq: NP_005326
• MIM: 601306
• Uniprot ID: P14317
• Chromosome Location: 3q13
• Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem; IL-5 Signaling Pathway, organism-specific biosystem
• Function: DNA binding; SH3 domain binding; protein complex binding; sequence-specific DNA binding transcription factor activity