Recombinant Human HCLS1

Cat.No. : HCLS1-27262TH
Product Overview : Recombinant fragment of Human HCLS1 with N terminal proprietary tag. Predicted MW 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : Hematopoietic lineage cell-specific protein is a protein that in humans is encoded by the HCLS1 gene.
Molecular Weight : 35.530kDa inclusive of tags
Tissue specificity : Expressed only in tissues and cells of hematopoietic origin.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
Sequence Similarities : Contains 4 cortactin repeats.Contains 1 SH3 domain.
Gene Name HCLS1 hematopoietic cell-specific Lyn substrate 1 [ Homo sapiens ]
Official Symbol HCLS1
Synonyms HCLS1; hematopoietic cell-specific Lyn substrate 1; hematopoietic lineage cell-specific protein; cortactin like; CTTNL; HS1;
Gene ID 3059
mRNA Refseq NM_005335
Protein Refseq NP_005326
MIM 601306
Uniprot ID P14317
Chromosome Location 3q13
Pathway B Cell Receptor Signaling Pathway, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem; IL-5 Signaling Pathway, organism-specific biosystem;
Function DNA binding; SH3 domain binding; protein complex binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HCLS1 Products

Required fields are marked with *

My Review for All HCLS1 Products

Required fields are marked with *

0
cart-icon