Recombinant Human HCLS1
| Cat.No. : | HCLS1-27262TH |
| Product Overview : | Recombinant fragment of Human HCLS1 with N terminal proprietary tag. Predicted MW 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 90 amino acids |
| Description : | Hematopoietic lineage cell-specific protein is a protein that in humans is encoded by the HCLS1 gene. |
| Molecular Weight : | 35.530kDa inclusive of tags |
| Tissue specificity : | Expressed only in tissues and cells of hematopoietic origin. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE |
| Sequence Similarities : | Contains 4 cortactin repeats.Contains 1 SH3 domain. |
| Gene Name | HCLS1 hematopoietic cell-specific Lyn substrate 1 [ Homo sapiens ] |
| Official Symbol | HCLS1 |
| Synonyms | HCLS1; hematopoietic cell-specific Lyn substrate 1; hematopoietic lineage cell-specific protein; cortactin like; CTTNL; HS1; |
| Gene ID | 3059 |
| mRNA Refseq | NM_005335 |
| Protein Refseq | NP_005326 |
| MIM | 601306 |
| Uniprot ID | P14317 |
| Chromosome Location | 3q13 |
| Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem; IL-5 Signaling Pathway, organism-specific biosystem; |
| Function | DNA binding; SH3 domain binding; protein complex binding; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| HCLS1-3354H | Recombinant Human HCLS1 Protein (Met1-Glu486), C-His tagged | +Inquiry |
| HCLS1-7518M | Recombinant Mouse HCLS1 Protein | +Inquiry |
| HCLS1-4086Z | Recombinant Zebrafish HCLS1 | +Inquiry |
| Hcls1-1101M | Recombinant Mouse Hcls1 Protein, MYC/DDK-tagged | +Inquiry |
| HCLS1-3512HF | Recombinant Full Length Human HCLS1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HCLS1-5611HCL | Recombinant Human HCLS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCLS1 Products
Required fields are marked with *
My Review for All HCLS1 Products
Required fields are marked with *
