Recombinant Human HCP5 Protein, GST-tagged
| Cat.No. : | HCP5-4632H |
| Product Overview : | Human HCP5 partial ORF ( NP_006665, 3 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HCP5 (HLA Complex P5 (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class. Diseases associated with HCP5 include Herpes Zoster. |
| Molecular Mass : | 36.85 kDa |
| AA Sequence : | LRMSEHRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGGPQGDPWVPHELLLPSLCDSSHASSWGSGSITCAWRGGDSSSHPLVS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HCP5 HLA complex P5 [ Homo sapiens ] |
| Official Symbol | HCP5 |
| Synonyms | HCP5; HLA complex P5; D6S2650E; P5 1; P5-1; |
| Gene ID | 10866 |
| MIM | 604676 |
| UniProt ID | Q6MZN7 |
| ◆ Recombinant Proteins | ||
| HCP5-4632H | Recombinant Human HCP5 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HCP5-5610HCL | Recombinant Human HCP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCP5 Products
Required fields are marked with *
My Review for All HCP5 Products
Required fields are marked with *
