Recombinant Human HCP5 Protein, GST-tagged

Cat.No. : HCP5-4632H
Product Overview : Human HCP5 partial ORF ( NP_006665, 3 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HCP5 (HLA Complex P5 (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class. Diseases associated with HCP5 include Herpes Zoster.
Molecular Mass : 36.85 kDa
AA Sequence : LRMSEHRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGGPQGDPWVPHELLLPSLCDSSHASSWGSGSITCAWRGGDSSSHPLVS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HCP5 HLA complex P5 [ Homo sapiens ]
Official Symbol HCP5
Synonyms HCP5; HLA complex P5; D6S2650E; P5 1; P5-1;
Gene ID 10866
MIM 604676
UniProt ID Q6MZN7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HCP5 Products

Required fields are marked with *

My Review for All HCP5 Products

Required fields are marked with *

0
cart-icon
0
compare icon