Recombinant Human HCRTR1 Protein, GST-tagged
Cat.No. : | HCRTR1-4634H |
Product Overview : | Human HCRTR1 full-length ORF ( AAH74796.1, 1 a.a. - 425 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B. [provided by RefSeq |
Molecular Mass : | 73.9 kDa |
AA Sequence : | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HCRTR1 hypocretin (orexin) receptor 1 [ Homo sapiens ] |
Official Symbol | HCRTR1 |
Synonyms | HCRTR1; hypocretin (orexin) receptor 1; orexin receptor type 1; OX1R; ox1-R; ox-1-R; orexin receptor 1; orexin receptor-1; hypocretin receptor 1; hypocretin receptor-1; hypocretin receptor type 1; |
Gene ID | 3061 |
mRNA Refseq | NM_001525 |
Protein Refseq | NP_001516 |
MIM | 602392 |
UniProt ID | O43613 |
◆ Recombinant Proteins | ||
HCRTR1-1124HFL | Recombinant Human HCRTR1 protein, His&Flag-tagged | +Inquiry |
RFL29228RF | Recombinant Full Length Rat Orexin Receptor Type 1(Hcrtr1) Protein, His-Tagged | +Inquiry |
HCRTR1-2811R | Recombinant Rat HCRTR1 Protein | +Inquiry |
HCRTR1-0696H | Recombinant Human HCRTR1 Protein (M1-Q246, K288-L380), Flag, 10×His tagged | +Inquiry |
HCRTR1-294H | Recombinant Human HCRTR1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
◆ Cell & Tissue Lysates | ||
HCRTR1-5609HCL | Recombinant Human HCRTR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCRTR1 Products
Required fields are marked with *
My Review for All HCRTR1 Products
Required fields are marked with *
0
Inquiry Basket