Recombinant Human HDAC3 Protein, GST-tagged
| Cat.No. : | HDAC3-4643H |
| Product Overview : | Human HDAC3 full-length ORF ( AAH00614, 1 a.a. - 428 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 72.82 kDa |
| AA Sequence : | MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HDAC3 histone deacetylase 3 [ Homo sapiens ] |
| Official Symbol | HDAC3 |
| Synonyms | HDAC3; histone deacetylase 3; HD3; RPD3; RPD3 2; SMAP45; RPD3-2; |
| Gene ID | 8841 |
| mRNA Refseq | NM_003883 |
| Protein Refseq | NP_003874 |
| MIM | 605166 |
| UniProt ID | O15379 |
| ◆ Recombinant Proteins | ||
| HDAC3-3908H | Recombinant Human HDAC3 protein(Met1-Ile428), His&GST-tagged | +Inquiry |
| HDAC3-2471R | Recombinant Rat HDAC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HDAC3-6312C | Recombinant Chicken HDAC3 | +Inquiry |
| HDAC3-394H | Active Recombinant Human Histone Deacetylase 3, His GST-tagged | +Inquiry |
| HDAC3-3099H | Recombinant Human HDAC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HDAC3-572HCL | Recombinant Human HDAC3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDAC3 Products
Required fields are marked with *
My Review for All HDAC3 Products
Required fields are marked with *
