Recombinant Human HDHD1, His-tagged

Cat.No. : HDHD1-29208TH
Product Overview : Recombinant full length Human HDHD1A with N terminal His tag; 248 amino acids with tag, predicted MWt 27.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 228 amino acids
Description : This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Conjugation : HIS
Molecular Weight : 27.400kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE
Sequence Similarities : Belongs to the HAD-like hydrolase superfamily. CbbY/CbbZ/Gph/YieH family.
Gene Name HDHD1 haloacid dehalogenase-like hydrolase domain containing 1 [ Homo sapiens ]
Official Symbol HDHD1
Synonyms HDHD1; haloacid dehalogenase-like hydrolase domain containing 1; FAM16AX, family with sequence similarity 16, member A, X linked , haloacid dehalogenase like hydrolase domain containing 1A , HDHD1A; pseudouridine-5-monophosphatase; DXF68S1E; GS1;
Gene ID 8226
mRNA Refseq NM_001178135
Protein Refseq NP_001171606
MIM 306480
Uniprot ID Q08623
Chromosome Location Xp22.32
Function hydrolase activity; metal ion binding; molecular_function; phosphatase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HDHD1 Products

Required fields are marked with *

My Review for All HDHD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon