Recombinant Human HDHD1, His-tagged
| Cat.No. : | HDHD1-29208TH |
| Product Overview : | Recombinant full length Human HDHD1A with N terminal His tag; 248 amino acids with tag, predicted MWt 27.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 228 amino acids |
| Description : | This gene encodes a member of the haloacid dehalogenase-like (HAD) hydrolase superfamily. The encoded protein has no known biological function. This gene has a pseudogene on chromosome 1. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. |
| Conjugation : | HIS |
| Molecular Weight : | 27.400kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE |
| Sequence Similarities : | Belongs to the HAD-like hydrolase superfamily. CbbY/CbbZ/Gph/YieH family. |
| Gene Name | HDHD1 haloacid dehalogenase-like hydrolase domain containing 1 [ Homo sapiens ] |
| Official Symbol | HDHD1 |
| Synonyms | HDHD1; haloacid dehalogenase-like hydrolase domain containing 1; FAM16AX, family with sequence similarity 16, member A, X linked , haloacid dehalogenase like hydrolase domain containing 1A , HDHD1A; pseudouridine-5-monophosphatase; DXF68S1E; GS1; |
| Gene ID | 8226 |
| mRNA Refseq | NM_001178135 |
| Protein Refseq | NP_001171606 |
| MIM | 306480 |
| Uniprot ID | Q08623 |
| Chromosome Location | Xp22.32 |
| Function | hydrolase activity; metal ion binding; molecular_function; phosphatase activity; |
| ◆ Recombinant Proteins | ||
| HDHD1-1700H | Recombinant Human Haloacid Dehalogenase-Like Hydrolase Domain Containing 1, His-tagged | +Inquiry |
| HDHD1-2793Z | Recombinant Zebrafish HDHD1 | +Inquiry |
| HDHD1-1099H | Recombinant Human HDHD1 Protein, MYC/DDK-tagged | +Inquiry |
| HDHD1-29208TH | Recombinant Human HDHD1, His-tagged | +Inquiry |
| HDHD1-806H | Recombinant Human Haloacid Dehalogenase-like Hydrolase Domain Containing 1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDHD1 Products
Required fields are marked with *
My Review for All HDHD1 Products
Required fields are marked with *
