Recombinant Human HEBP1 Protein, GST-tagged
| Cat.No. : | HEBP1-4671H |
| Product Overview : | Human HEBP1 full-length ORF ( AAH16277.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The full-length protein encoded by this gene is an intracellular tetrapyrrole-binding protein. This protein includes a natural chemoattractant peptide of 21 amino acids at the N-terminus, which is a natural ligand for formyl peptide receptor-like receptor 2 (FPRL2) and promotes calcium mobilization and chemotaxis in monocytes and dendritic cells. [provided by RefSeq |
| Molecular Mass : | 47.5 kDa |
| AA Sequence : | MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTNDKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HEBP1 heme binding protein 1 [ Homo sapiens ] |
| Official Symbol | HEBP1 |
| Synonyms | HEBP1; heme binding protein 1; heme-binding protein 1; HBP; HEBP; p22HBP; |
| Gene ID | 50865 |
| mRNA Refseq | NM_015987 |
| Protein Refseq | NP_057071 |
| MIM | 605826 |
| UniProt ID | Q9NRV9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HEBP1 Products
Required fields are marked with *
My Review for All HEBP1 Products
Required fields are marked with *



