Recombinant Human HELZ Protein, GST-tagged

Cat.No. : HELZ-4685H
Product Overview : Human HELZ partial ORF ( NP_055692, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HELZ is a member of the superfamily I class of RNA helicases. RNA helicases alter the conformation of RNA by unwinding double-stranded regions, thereby altering the biologic activity of the RNA molecule and regulating access to other proteins (Wagner et al., 1999 [PubMed 10471385]).[supplied by OMIM
Molecular Mass : 36.74 kDa
AA Sequence : MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESLLYRIASFLQLKNYVQADEDCRHVLGEGLAKGEDAFRAVLC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HELZ helicase with zinc finger [ Homo sapiens ]
Official Symbol HELZ
Synonyms HELZ; helicase with zinc finger; probable helicase with zinc finger domain; DHRC; down regulated in human cancers; HUMORF5; KIAA0054; helicase with zinc finger domain; down-regulated in human cancers protein; DRHC; MGC163454; DKFZp586G1924;
Gene ID 9931
mRNA Refseq NM_014877
Protein Refseq NP_055692
MIM 606699
UniProt ID P42694

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HELZ Products

Required fields are marked with *

My Review for All HELZ Products

Required fields are marked with *

0
cart-icon
0
compare icon