Recombinant Human HELZ Protein, GST-tagged
Cat.No. : | HELZ-4685H |
Product Overview : | Human HELZ partial ORF ( NP_055692, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HELZ is a member of the superfamily I class of RNA helicases. RNA helicases alter the conformation of RNA by unwinding double-stranded regions, thereby altering the biologic activity of the RNA molecule and regulating access to other proteins (Wagner et al., 1999 [PubMed 10471385]).[supplied by OMIM |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESLLYRIASFLQLKNYVQADEDCRHVLGEGLAKGEDAFRAVLC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HELZ helicase with zinc finger [ Homo sapiens ] |
Official Symbol | HELZ |
Synonyms | HELZ; helicase with zinc finger; probable helicase with zinc finger domain; DHRC; down regulated in human cancers; HUMORF5; KIAA0054; helicase with zinc finger domain; down-regulated in human cancers protein; DRHC; MGC163454; DKFZp586G1924; |
Gene ID | 9931 |
mRNA Refseq | NM_014877 |
Protein Refseq | NP_055692 |
MIM | 606699 |
UniProt ID | P42694 |
◆ Recombinant Proteins | ||
HELZ-4685H | Recombinant Human HELZ Protein, GST-tagged | +Inquiry |
HELZ-4120M | Recombinant Mouse HELZ Protein, His (Fc)-Avi-tagged | +Inquiry |
HELZ-12461Z | Recombinant Zebrafish HELZ | +Inquiry |
HELZ-7570M | Recombinant Mouse HELZ Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HELZ Products
Required fields are marked with *
My Review for All HELZ Products
Required fields are marked with *