Recombinant Human HES1 Protein, GST-tagged
Cat.No. : | HES1-4699H |
Product Overview : | Human HES1 full-length ORF ( AAH39152.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq |
Molecular Mass : | 55.7 kDa |
AA Sequence : | MPADIMEKNSSSPVAASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HES1 hairy and enhancer of split 1, (Drosophila) [ Homo sapiens ] |
Official Symbol | HES1 |
Synonyms | HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila) , HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1; hairy homolog; hairy-like protein; class B basic helix-loop-helix protein 39; HHL; HRY; HES-1; |
Gene ID | 3280 |
mRNA Refseq | NM_005524 |
Protein Refseq | NP_005515 |
MIM | 139605 |
UniProt ID | Q14469 |
◆ Recombinant Proteins | ||
HES1-2972H | Recombinant Human HES1 protein, His-tagged | +Inquiry |
HES1-3515HF | Recombinant Full Length Human HES1 Protein, GST-tagged | +Inquiry |
HES1-4699H | Recombinant Human HES1 Protein, GST-tagged | +Inquiry |
HES1-289H | Recombinant Human HES1, His-tagged | +Inquiry |
HES1-1831HFL | Recombinant Full Length Human HES1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HES1-5582HCL | Recombinant Human HES1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HES1 Products
Required fields are marked with *
My Review for All HES1 Products
Required fields are marked with *