Recombinant Human HES1 Protein, GST-tagged

• Cat.No.: HES1-4699H
• Product Overview: Human HES1 full-length ORF ( AAH39152.1, 1 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. [provided by RefSeq
• Molecular Mass: 55.7 kDa
• AA Sequence: MPADIMEKNSSSPVAASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HES1 hairy and enhancer of split 1, (Drosophila) [ Homo sapiens ]
• Official Symbol: HES1
• Synonyms: HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila) , HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1; hairy homolog; hairy-like protein; class B basic helix-loop-helix protein 39; HHL; HRY; HES-1
• Gene ID: 3280
• mRNA Refseq: NM_005524
• Protein Refseq: NP_005515
• MIM: 139605
• UniProt ID: Q14469