Recombinant Human HES5 Protein, GST-tagged

Cat.No. : HES5-4705H
Product Overview : Human HES5 partial ORF (NP_001010926.1, 28 a.a. - 121 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 28-121 a.a.
Description : This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq
Molecular Mass : 35.97 kDa
AA Sequence : RRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HES5 hairy and enhancer of split 5 (Drosophila) [ Homo sapiens ]
Official Symbol HES5
Synonyms HES5; hairy and enhancer of split 5 (Drosophila); bHLHb38;
Gene ID 256482
MIM 607348
UniProt ID Q5TA89

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HES5 Products

Required fields are marked with *

My Review for All HES5 Products

Required fields are marked with *

0
cart-icon