Recombinant Human HES5 Protein, GST-tagged
| Cat.No. : | HES5-4705H |
| Product Overview : | Human HES5 partial ORF (NP_001010926.1, 28 a.a. - 121 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 28-121 a.a. |
| Description : | This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq |
| Molecular Mass : | 35.97 kDa |
| AA Sequence : | RRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HES5 hairy and enhancer of split 5 (Drosophila) [ Homo sapiens ] |
| Official Symbol | HES5 |
| Synonyms | HES5; hairy and enhancer of split 5 (Drosophila); bHLHb38; |
| Gene ID | 256482 |
| MIM | 607348 |
| UniProt ID | Q5TA89 |
| ◆ Recombinant Proteins | ||
| Hes5-5399M | Recombinant Mouse Hes5 protein, Avi-tagged, Biotinylated | +Inquiry |
| Hes5-5398M | Recombinant Mouse Hes5 protein | +Inquiry |
| HES5-7589M | Recombinant Mouse HES5 Protein | +Inquiry |
| Hes5-5400M | Recombinant Mouse Hes5 protein | +Inquiry |
| HES5-379H | Recombinant Human HES5 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HES5-5581HCL | Recombinant Human HES5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HES5 Products
Required fields are marked with *
My Review for All HES5 Products
Required fields are marked with *
