Recombinant Human HEXIM2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | HEXIM2-2599H |
| Product Overview : | HEXIM2 MS Standard C13 and N15-labeled recombinant protein (NP_653209) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the HEXIM family of proteins. This protein is a component of the 7SK small nuclear ribonucleoprotein. This protein has been found to negatively regulate the kinase activity of the cyclin-dependent kinase P-TEFb, which phosphorylates multiple target proteins to promote transcriptional elongation. This gene is located approximately 7 kb downstream from related family member HEXIM1 on chromosome 17. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : | 32.4 kDa |
| AA Sequence : | MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESHSEDEDLAGAVGGLGWNSRSPRTQSPGGCSAEAVLARKKHRRRPSKRKRHWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAPYNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | HEXIM2 hexamethylene bis-acetamide inducible 2 [ Homo sapiens (human) ] |
| Official Symbol | HEXIM2 |
| Synonyms | HEXIM2; hexamethylene bis-acetamide inducible 2; protein HEXIM2; FLJ32384; MAQ1 paralog; hexamthylene bis-acetamide inducible 2; hexamethylene bis-acetamide-inducible protein 2; hexamethylene-bis-acetamide-inducible transcript 2; L3; |
| Gene ID | 124790 |
| mRNA Refseq | NM_144608 |
| Protein Refseq | NP_653209 |
| MIM | 615695 |
| UniProt ID | Q96MH2 |
| ◆ Recombinant Proteins | ||
| HEXIM2-4714H | Recombinant Human HEXIM2 Protein, GST-tagged | +Inquiry |
| HEXIM2-2162HFL | Recombinant Full Length Human HEXIM2 Protein, C-Flag-tagged | +Inquiry |
| HEXIM2-1064H | Recombinant Human HEXIM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HEXIM2-2599H | Recombinant Human HEXIM2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HEXIM2-2072R | Recombinant Rhesus monkey HEXIM2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HEXIM2 Products
Required fields are marked with *
My Review for All HEXIM2 Products
Required fields are marked with *
