Recombinant Human HHEX protein, Arginine-tagged

Cat.No. : HHEX-137H
Product Overview : Recombinant human Hex protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : QYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTSLVSPYRTPVYEPTPIH PAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTIE LEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQN KGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAGLEESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for human HSC cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name HHEX hematopoietically expressed homeobox [ Homo sapiens ]
Official Symbol HHEX
Synonyms HHEX; hematopoietically expressed homeobox; PRHX; hematopoietically-expressed homeobox protein HHEX; HEX; HOX11L PEN; homeobox protein HEX;PRH; HMPH; HOX11L-PEN;
Gene ID 3087
mRNA Refseq NM_002729
Protein Refseq NP_002720
MIM 604420
UniProt ID Q03014
Chromosome Location 10q23.33
Pathway Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem;
Function DNA binding, bending; HMG box domain binding; TBP-class protein binding; chromatin binding; eukaryotic initiation factor 4E binding; protein binding; protein homodimerization activity; repressing transcription factor binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding; transcription regulatory region DNA binding; transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HHEX Products

Required fields are marked with *

My Review for All HHEX Products

Required fields are marked with *

0
cart-icon
0
compare icon