Recombinant Human HHEX protein, Arginine-tagged
Cat.No. : | HHEX-137H |
Product Overview : | Recombinant human Hex protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | QYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTSLVSPYRTPVYEPTPIH PAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTIE LEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQN KGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAGLEESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for human HSC cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | HHEX hematopoietically expressed homeobox [ Homo sapiens ] |
Official Symbol | HHEX |
Synonyms | HHEX; hematopoietically expressed homeobox; PRHX; hematopoietically-expressed homeobox protein HHEX; HEX; HOX11L PEN; homeobox protein HEX;PRH; HMPH; HOX11L-PEN; |
Gene ID | 3087 |
mRNA Refseq | NM_002729 |
Protein Refseq | NP_002720 |
MIM | 604420 |
UniProt ID | Q03014 |
Chromosome Location | 10q23.33 |
Pathway | Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; |
Function | DNA binding, bending; HMG box domain binding; TBP-class protein binding; chromatin binding; eukaryotic initiation factor 4E binding; protein binding; protein homodimerization activity; repressing transcription factor binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding; transcription regulatory region DNA binding; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
Hhex-1124M | Recombinant Mouse Hhex Protein, MYC/DDK-tagged | +Inquiry |
HHEX-7611M | Recombinant Mouse HHEX Protein | +Inquiry |
HHEX-6804C | Recombinant Chicken HHEX | +Inquiry |
HHEX-3539HF | Recombinant Full Length Human HHEX Protein, GST-tagged | +Inquiry |
HHEX-253H | Recombinant Human HHEX Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HHEX-5570HCL | Recombinant Human HHEX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HHEX Products
Required fields are marked with *
My Review for All HHEX Products
Required fields are marked with *
0
Inquiry Basket