Recombinant Human HHEX protein, Arginine-tagged

• Cat.No.: HHEX-137H
• Product Overview: Recombinant human Hex protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: QYPHPGPAAGAVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAPTPAPTLPSPNSSFTSLVSPYRTPVYEPTPIH PAFSHHSAAALAAAYGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQTIE LEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQN KGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKSYFNAGLEESGGGGSPGRRRRRRRRRRR
• Purity: >90% by SDS-PAGE
• Applications: 1. Protein transduction for human HSC cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: HHEX hematopoietically expressed homeobox [ Homo sapiens ]
• Official Symbol: HHEX
• Synonyms: HHEX; hematopoietically expressed homeobox; PRHX; hematopoietically-expressed homeobox protein HHEX; HEX; HOX11L PEN; homeobox protein HEX;PRH; HMPH; HOX11L-PEN
• Gene ID: 3087
• mRNA Refseq: NM_002729
• Protein Refseq: NP_002720
• MIM: 604420
• UniProt ID: Q03014
• Chromosome Location: 10q23.33
• Pathway: Maturity onset diabetes of the young, organism-specific biosystem; Maturity onset diabetes of the young, conserved biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem
• Function: DNA binding, bending; HMG box domain binding; TBP-class protein binding; chromatin binding; eukaryotic initiation factor 4E binding; protein binding; protein homodimerization activity; repressing transcription factor binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding; transcription regulatory region DNA binding; transcription regulatory region DNA binding