Recombinant Human HHLA3 protein, GST-tagged
Cat.No. : | HHLA3-4653H |
Product Overview : | Recombinant Human HHLA3 protein(1-53 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-53 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | HHLA3 HERV-H LTR-associating 3 [ Homo sapiens ] |
Official Symbol | HHLA3 |
Synonyms | HHLA3; HERV-H LTR-associating 3; HERV-H LTR-associating protein 3; human endogenous retrovirus-H long terminal repeat-associating 3; human endogenous retrovirus-H long terminal repeat-associating protein 3; |
Gene ID | 11147 |
mRNA Refseq | NM_001031693 |
Protein Refseq | NP_001026863 |
MIM | 604372 |
UniProt ID | Q9XRX5 |
◆ Recombinant Proteins | ||
HHLA3-2485H | Recombinant Human HHLA3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HHLA3 -250H | Recombinant Human HHLA3 Protein, His-tagged | +Inquiry |
HHLA3-4653H | Recombinant Human HHLA3 protein, GST-tagged | +Inquiry |
HHLA3-247H | Recombinant Human HHLA3 Protein, MYC/DDK-tagged | +Inquiry |
HHLA3-4739H | Recombinant Human HHLA3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HHLA3-5568HCL | Recombinant Human HHLA3 293 Cell Lysate | +Inquiry |
HHLA3-5567HCL | Recombinant Human HHLA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HHLA3 Products
Required fields are marked with *
My Review for All HHLA3 Products
Required fields are marked with *