Recombinant Human HINT2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | HINT2-4767H |
| Product Overview : | HINT2 MS Standard C13 and N15-labeled recombinant protein (NP_115982) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides. |
| Molecular Mass : | 17.2 kDa |
| AA Sequence : | MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | HINT2 histidine triad nucleotide binding protein 2 [ Homo sapiens (human) ] |
| Official Symbol | HINT2 |
| Synonyms | HINT2; histidine triad nucleotide binding protein 2; histidine triad nucleotide-binding protein 2, mitochondrial; HINT-2; HINT-3; HIT-17kDa; PKCI-1-related HIT protein; protein kinase C inhibitor-2; HIT-17; |
| Gene ID | 84681 |
| mRNA Refseq | NM_032593 |
| Protein Refseq | NP_115982 |
| MIM | 609997 |
| UniProt ID | Q9BX68 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HINT2 Products
Required fields are marked with *
My Review for All HINT2 Products
Required fields are marked with *



