Recombinant Human HINT2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HINT2-4767H |
Product Overview : | HINT2 MS Standard C13 and N15-labeled recombinant protein (NP_115982) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides. |
Molecular Mass : | 17.2 kDa |
AA Sequence : | MAAAVVLAAGLRAARRAVAATGVRGGQVRGAAGVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVAPQAPVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HINT2 histidine triad nucleotide binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | HINT2 |
Synonyms | HINT2; histidine triad nucleotide binding protein 2; histidine triad nucleotide-binding protein 2, mitochondrial; HINT-2; HINT-3; HIT-17kDa; PKCI-1-related HIT protein; protein kinase C inhibitor-2; HIT-17; |
Gene ID | 84681 |
mRNA Refseq | NM_032593 |
Protein Refseq | NP_115982 |
MIM | 609997 |
UniProt ID | Q9BX68 |
◆ Recombinant Proteins | ||
HINT2-3470HF | Recombinant Full Length Human HINT2 Protein, GST-tagged | +Inquiry |
HINT2-1903R | Recombinant Rhesus Macaque HINT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Hint2-3397M | Recombinant Mouse Hint2 Protein, Myc/DDK-tagged | +Inquiry |
HINT2-2082R | Recombinant Rhesus monkey HINT2 Protein, His-tagged | +Inquiry |
Hint2-1593M | Recombinant Mouse Hint2 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HINT2-5557HCL | Recombinant Human HINT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HINT2 Products
Required fields are marked with *
My Review for All HINT2 Products
Required fields are marked with *
0
Inquiry Basket