Recombinant Human HIP1R, His-tagged

• Cat.No.: HIP1R-29320TH
• Product Overview: Recombinant fragment, corresponding to amino acids 729-876 of Human HIP1R with a N terminal His tag; Pred MWt 17kDa:

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 729-876 a.a.
• Description: Huntingtin-interacting protein 1-related protein is a protein that in humans is encoded by the HIP1R gene.
• Conjugation: HIS
• Form: Lyophilised:Reconstitution with 99 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQELK PKSLDVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMN QARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSL QKEIVESGRGAATQQEFYAKNSRWTEGLISAS

Gene Information

• Gene Name: HIP1R huntingtin interacting protein 1 related [ Homo sapiens ]
• Official Symbol: HIP1R
• Synonyms: HIP1R; huntingtin interacting protein 1 related; huntingtin-interacting protein 1-related protein; FLJ14000; HIP3; HIP12; ILWEQ; KIAA0655
• Gene ID: 9026
• mRNA Refseq: NM_003959
• Protein Refseq: NP_003950
• MIM: 605613
• Uniprot ID: O75146
• Chromosome Location: 12q24
• Pathway: Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem
• Function: actin binding; phosphatidylinositol binding; protein binding