Recombinant Human HIP1R, His-tagged
Cat.No. : | HIP1R-29320TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 729-876 of Human HIP1R with a N terminal His tag; Pred MWt 17kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 729-876 a.a. |
Description : | Huntingtin-interacting protein 1-related protein is a protein that in humans is encoded by the HIP1R gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 99 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQELK PKSLDVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMN QARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSL QKEIVESGRGAATQQEFYAKNSRWTEGLISAS |
Gene Name | HIP1R huntingtin interacting protein 1 related [ Homo sapiens ] |
Official Symbol | HIP1R |
Synonyms | HIP1R; huntingtin interacting protein 1 related; huntingtin-interacting protein 1-related protein; FLJ14000; HIP3; HIP12; ILWEQ; KIAA0655; |
Gene ID | 9026 |
mRNA Refseq | NM_003959 |
Protein Refseq | NP_003950 |
MIM | 605613 |
Uniprot ID | O75146 |
Chromosome Location | 12q24 |
Pathway | Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem; |
Function | actin binding; phosphatidylinositol binding; protein binding; |
◆ Recombinant Proteins | ||
HIP1R-2363C | Recombinant Chicken HIP1R | +Inquiry |
HIP1R-7857H | Recombinant Human HIP1R protein, His & T7-tagged | +Inquiry |
HIP1R-4385H | Recombinant Human HIP1R Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HIP1R-3232H | Recombinant Human HIP1R Protein (Ser771-Ala1012), N-His tagged | +Inquiry |
HIP1R-7635M | Recombinant Mouse HIP1R Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIP1R-789HCL | Recombinant Human HIP1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIP1R Products
Required fields are marked with *
My Review for All HIP1R Products
Required fields are marked with *