Recombinant Human HIP1R, His-tagged

Cat.No. : HIP1R-29320TH
Product Overview : Recombinant fragment, corresponding to amino acids 729-876 of Human HIP1R with a N terminal His tag; Pred MWt 17kDa:
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 729-876 a.a.
Description : Huntingtin-interacting protein 1-related protein is a protein that in humans is encoded by the HIP1R gene.
Conjugation : HIS
Form : Lyophilised:Reconstitution with 99 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GARALELMGQLQDQQALRHMQASLVRTPLQGILQLGQELK PKSLDVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMN QARHASSGVKLEVNERILNSCTDLMKAIRLLVTTSTSL QKEIVESGRGAATQQEFYAKNSRWTEGLISAS
Gene Name HIP1R huntingtin interacting protein 1 related [ Homo sapiens ]
Official Symbol HIP1R
Synonyms HIP1R; huntingtin interacting protein 1 related; huntingtin-interacting protein 1-related protein; FLJ14000; HIP3; HIP12; ILWEQ; KIAA0655;
Gene ID 9026
mRNA Refseq NM_003959
Protein Refseq NP_003950
MIM 605613
Uniprot ID O75146
Chromosome Location 12q24
Pathway Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem;
Function actin binding; phosphatidylinositol binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIP1R Products

Required fields are marked with *

My Review for All HIP1R Products

Required fields are marked with *

0
cart-icon