Recombinant Human HIRA protein(371-450 aa), C-His-tagged

Cat.No. : HIRA-2785H
Product Overview : Recombinant Human HIRA protein(P54198)(371-450 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 371-450 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KSRIHQSTYGKSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKSAATREMGSATSVAGVVNGESLEDIRKNLLKKQV
Gene Name HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol HIRA
Synonyms HIRA; HIR histone cell cycle regulation defective homolog A (S. cerevisiae); HIR (histone cell cycle regulation defective) homolog A (S. cerevisiae) , TUPLE1; protein HIRA; DGCR1; DiGeorge critical region gene 1; TUP1; TUP1-like enhancer of split protein 1; TUPLE1;
Gene ID 7290
mRNA Refseq NM_003325
Protein Refseq NP_003316
MIM 600237
UniProt ID P54198

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIRA Products

Required fields are marked with *

My Review for All HIRA Products

Required fields are marked with *

0
cart-icon
0
compare icon