Recombinant Human HIRA protein(371-450 aa), C-His-tagged
| Cat.No. : | HIRA-2785H |
| Product Overview : | Recombinant Human HIRA protein(P54198)(371-450 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 371-450 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | KSRIHQSTYGKSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKSAATREMGSATSVAGVVNGESLEDIRKNLLKKQV |
| Gene Name | HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | HIRA |
| Synonyms | HIRA; HIR histone cell cycle regulation defective homolog A (S. cerevisiae); HIR (histone cell cycle regulation defective) homolog A (S. cerevisiae) , TUPLE1; protein HIRA; DGCR1; DiGeorge critical region gene 1; TUP1; TUP1-like enhancer of split protein 1; TUPLE1; |
| Gene ID | 7290 |
| mRNA Refseq | NM_003325 |
| Protein Refseq | NP_003316 |
| MIM | 600237 |
| UniProt ID | P54198 |
| ◆ Recombinant Proteins | ||
| HIRA-5805C | Recombinant Chicken HIRA | +Inquiry |
| HIRA-2084R | Recombinant Rhesus monkey HIRA Protein, His-tagged | +Inquiry |
| HIRA-2785H | Recombinant Human HIRA protein(371-450 aa), C-His-tagged | +Inquiry |
| HIRA-7640M | Recombinant Mouse HIRA Protein | +Inquiry |
| HIRA-4171M | Recombinant Mouse HIRA Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HIRA-791HCL | Recombinant Human HIRA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIRA Products
Required fields are marked with *
My Review for All HIRA Products
Required fields are marked with *
