Recombinant Human HIRA protein(371-450 aa), C-His-tagged

• Cat.No.: HIRA-2785H
• Product Overview: Recombinant Human HIRA protein(P54198)(371-450 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 371-450 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KSRIHQSTYGKSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKSAATREMGSATSVAGVVNGESLEDIRKNLLKKQV

Gene Information

• Gene Name: HIRA HIR histone cell cycle regulation defective homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: HIRA
• Synonyms: HIRA; HIR histone cell cycle regulation defective homolog A (S. cerevisiae); HIR (histone cell cycle regulation defective) homolog A (S. cerevisiae) , TUPLE1; protein HIRA; DGCR1; DiGeorge critical region gene 1; TUP1; TUP1-like enhancer of split protein 1; TUPLE1
• Gene ID: 7290
• mRNA Refseq: NM_003325
• Protein Refseq: NP_003316
• MIM: 600237
• UniProt ID: P54198