Recombinant Human HIRIP3, His-tagged

Cat.No. : HIRIP3-27080TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-183 of Human HIRIP3 with N terminal His tag; 183 amino acids, 21kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-183 a.a.
Description : The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae. The structural features of the HIRA protein suggest that it may function as part of a multiprotein complex. Several cDNAs encoding HIRA-interacting proteins, or HIRIPs, have been identified. In vitro, the protein encoded by this gene binds HIRA, as well as H2B and H3 core histones, indicating that a complex containing HIRA-HIRIP3 could function in some aspects of chromatin and histone metabolism. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 104 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAREKEMQEFTRSFFRGRPDLSTLTHSIVRRRYLAHSGRS HLEPEEKQALKRLVEEELLKMQVDEAASREDKLDLTKK GKRPPTPCSDPERKRFRFNSESESGSEASSPDYFGPPAKNGVAAEVSPAKEENPRRASKAVEESSDEERQRDLPAQRG EESSEEEEKGYKGKTRKKPVVKKQAPG
Gene Name HIRIP3 HIRA interacting protein 3 [ Homo sapiens ]
Official Symbol HIRIP3
Synonyms HIRIP3; HIRA interacting protein 3; HIRA-interacting protein 3;
Gene ID 8479
mRNA Refseq NM_001197323
Protein Refseq NP_001184252
MIM 603365
Uniprot ID Q9BW71
Chromosome Location 16p12.1
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIRIP3 Products

Required fields are marked with *

My Review for All HIRIP3 Products

Required fields are marked with *

0
cart-icon