Recombinant Human HIRIP3, His-tagged
Cat.No. : | HIRIP3-27080TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-183 of Human HIRIP3 with N terminal His tag; 183 amino acids, 21kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-183 a.a. |
Description : | The HIRA protein shares sequence similarity with Hir1p and Hir2p, the two corepressors of histone gene transcription characterized in the yeast, Saccharomyces cerevisiae. The structural features of the HIRA protein suggest that it may function as part of a multiprotein complex. Several cDNAs encoding HIRA-interacting proteins, or HIRIPs, have been identified. In vitro, the protein encoded by this gene binds HIRA, as well as H2B and H3 core histones, indicating that a complex containing HIRA-HIRIP3 could function in some aspects of chromatin and histone metabolism. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 104 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAREKEMQEFTRSFFRGRPDLSTLTHSIVRRRYLAHSGRS HLEPEEKQALKRLVEEELLKMQVDEAASREDKLDLTKK GKRPPTPCSDPERKRFRFNSESESGSEASSPDYFGPPAKNGVAAEVSPAKEENPRRASKAVEESSDEERQRDLPAQRG EESSEEEEKGYKGKTRKKPVVKKQAPG |
Gene Name | HIRIP3 HIRA interacting protein 3 [ Homo sapiens ] |
Official Symbol | HIRIP3 |
Synonyms | HIRIP3; HIRA interacting protein 3; HIRA-interacting protein 3; |
Gene ID | 8479 |
mRNA Refseq | NM_001197323 |
Protein Refseq | NP_001184252 |
MIM | 603365 |
Uniprot ID | Q9BW71 |
Chromosome Location | 16p12.1 |
Function | protein binding; |
◆ Recombinant Proteins | ||
HIRIP3-3563HF | Recombinant Full Length Human HIRIP3 Protein, GST-tagged | +Inquiry |
HIRIP3-27080TH | Recombinant Human HIRIP3, His-tagged | +Inquiry |
HIRIP3-4172M | Recombinant Mouse HIRIP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HIRIP3-2614H | Recombinant Human HIRIP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HIRIP3-7641M | Recombinant Mouse HIRIP3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIRIP3-792HCL | Recombinant Human HIRIP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIRIP3 Products
Required fields are marked with *
My Review for All HIRIP3 Products
Required fields are marked with *