Recombinant Human HIST1H1D protein(2-221aa), MBP&His-tagged
| Cat.No. : | HIST1H1D-4422H |
| Product Overview : | Recombinant Human HIST1H1D protein(P16402)(2-221aa), fused with N-terminal MBP and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&MBP |
| Protein Length : | 2-221aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 66.0 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | SETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK |
| Gene Name | HIST1H1D histone cluster 1, H1d [ Homo sapiens ] |
| Official Symbol | HIST1H1D |
| Synonyms | HIST1H1D; histone cluster 1, H1d; H1 histone family, member 3 , H1F3, histone 1, H1d; histone H1.3; H1.3; H1d; H1s 2; histone H1c; histone 1, H1d; H1 histone family, member 3; H1D; H1F3; MGC138176; |
| Gene ID | 3007 |
| mRNA Refseq | NM_005320 |
| Protein Refseq | NP_005311 |
| MIM | 142210 |
| UniProt ID | P16402 |
| ◆ Recombinant Proteins | ||
| HIST1H1D-4176M | Recombinant Mouse HIST1H1D Protein, His (Fc)-Avi-tagged | +Inquiry |
| HIST1H1D-2505R | Recombinant Rat HIST1H1D Protein, His (Fc)-Avi-tagged | +Inquiry |
| HIST1H1D-1908R | Recombinant Rhesus Macaque HIST1H1D Protein, His (Fc)-Avi-tagged | +Inquiry |
| HIST1H1D-2133H | Recombinant Human Histone Cluster 1, H1d | +Inquiry |
| HIST1H1D-4774H | Recombinant Human HIST1H1D Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HIST1H1D-5552HCL | Recombinant Human HIST1H1D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIST1H1D Products
Required fields are marked with *
My Review for All HIST1H1D Products
Required fields are marked with *
