Recombinant Human HIST1H1D protein(2-221aa), MBP&His-tagged
Cat.No. : | HIST1H1D-4422H |
Product Overview : | Recombinant Human HIST1H1D protein(P16402)(2-221aa), fused with N-terminal MBP and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&MBP |
Protein Length : | 2-221aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 66.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK |
Gene Name | HIST1H1D histone cluster 1, H1d [ Homo sapiens ] |
Official Symbol | HIST1H1D |
Synonyms | HIST1H1D; histone cluster 1, H1d; H1 histone family, member 3 , H1F3, histone 1, H1d; histone H1.3; H1.3; H1d; H1s 2; histone H1c; histone 1, H1d; H1 histone family, member 3; H1D; H1F3; MGC138176; |
Gene ID | 3007 |
mRNA Refseq | NM_005320 |
Protein Refseq | NP_005311 |
MIM | 142210 |
UniProt ID | P16402 |
◆ Recombinant Proteins | ||
HIST1H1D-2505R | Recombinant Rat HIST1H1D Protein, His (Fc)-Avi-tagged | +Inquiry |
HIST1H1D-2133H | Recombinant Human Histone Cluster 1, H1d | +Inquiry |
HIST1H1D-3565HF | Recombinant Full Length Human HIST1H1D Protein, GST-tagged | +Inquiry |
HIST1H1D-7645M | Recombinant Mouse HIST1H1D Protein | +Inquiry |
HIST1H1D-2087R | Recombinant Rhesus monkey HIST1H1D Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H1D-5552HCL | Recombinant Human HIST1H1D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIST1H1D Products
Required fields are marked with *
My Review for All HIST1H1D Products
Required fields are marked with *
0
Inquiry Basket