Recombinant Human HIST1H1D protein(2-221aa), MBP&His-tagged

Cat.No. : HIST1H1D-4422H
Product Overview : Recombinant Human HIST1H1D protein(P16402)(2-221aa), fused with N-terminal MBP and C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&MBP
Protein Length : 2-221aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 66.0 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : SETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK
Gene Name HIST1H1D histone cluster 1, H1d [ Homo sapiens ]
Official Symbol HIST1H1D
Synonyms HIST1H1D; histone cluster 1, H1d; H1 histone family, member 3 , H1F3, histone 1, H1d; histone H1.3; H1.3; H1d; H1s 2; histone H1c; histone 1, H1d; H1 histone family, member 3; H1D; H1F3; MGC138176;
Gene ID 3007
mRNA Refseq NM_005320
Protein Refseq NP_005311
MIM 142210
UniProt ID P16402

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIST1H1D Products

Required fields are marked with *

My Review for All HIST1H1D Products

Required fields are marked with *

0
cart-icon
0
compare icon