Recombinant Human HIST1H2AA Protein, GST-tagged

Cat.No. : HIST1H2AA-4776H
Product Overview : Human HIST1H2AA full-length ORF (AAH62211.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq
Molecular Mass : 40.81 kDa
AA Sequence : MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHHHKAQSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIST1H2AA histone cluster 1, H2aa [ Homo sapiens ]
Official Symbol HIST1H2AA
Synonyms HIST1H2AA; histone cluster 1, H2aa; H2A histone family, member R , histone 1, H2aa; histone H2A type 1-A; bA317E16.2; H2AFR; histone H2A/r; histone 1, H2aa; H2A histone family, member R; H2AA;
Gene ID 221613
mRNA Refseq NM_170745
Protein Refseq NP_734466
MIM 613499
UniProt ID Q96QV6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIST1H2AA Products

Required fields are marked with *

My Review for All HIST1H2AA Products

Required fields are marked with *

0
cart-icon
0
compare icon