Recombinant Human HK1 protein, His-SUMO-tagged
| Cat.No. : | HK1-3035H |
| Product Overview : | Recombinant Human HK1 protein(P19367)(476-917aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 476-917aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 65.3 kDa |
| AA Sequence : | HFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | HK1 hexokinase 1 [ Homo sapiens ] |
| Official Symbol | HK1 |
| Synonyms | HK1; hexokinase 1; hexokinase-1; HK I; glycolytic enzyme; hexokinase type I; brain form hexokinase; HKI; HXK1; HK1-ta; HK1-tb; HK1-tc; |
| Gene ID | 3098 |
| mRNA Refseq | NM_000188 |
| Protein Refseq | NP_000179 |
| MIM | 142600 |
| UniProt ID | P19367 |
| ◆ Recombinant Proteins | ||
| Hk1-7655M | Recombinant Mouse Hk1 protein, His-tagged | +Inquiry |
| HK1-5425H | Recombinant Human HK1 protein, His-tagged | +Inquiry |
| HK1-7653H | Recombinant Human HK1 protein, His & GST-tagged | +Inquiry |
| HK1-2516R | Recombinant Rat HK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HK1-3034H | Recombinant Human HK1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HK1-199HKCL | Human HK1 Knockdown Cell Lysate | +Inquiry |
| HK1-794HCL | Recombinant Human HK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HK1 Products
Required fields are marked with *
My Review for All HK1 Products
Required fields are marked with *
