Recombinant Human HK3 Protein, His-tagged

Cat.No. : HK3-155H
Product Overview : Recombinant Human HK3 fused with His tag at C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 3. Similar to hexokinases 1 and 2, this allosteric enzyme is inhibited by its product glucose-6-phosphate.
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass : 100kD
AA Sequence : MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEPRSQEFVIPQEVMLGAGQQLFDFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRSTLISWTKGFRCSGVEGQDVVQLLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRPCEVGLVVDTGTNACYMEEA
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name HK3 hexokinase 3 (white cell) [ Homo sapiens ]
Official Symbol HK3
Synonyms HK3; hexokinase 3 (white cell); hexokinase-3; HK III; hexokinase type III; ATP:D-hexose 6-phosphotransferase; HXK3; HKIII;
Gene ID 3101
mRNA Refseq NM_002115
Protein Refseq NP_002106
MIM 142570
UniProt ID P52790

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HK3 Products

Required fields are marked with *

My Review for All HK3 Products

Required fields are marked with *

0
cart-icon