Recombinant Human HK3 Protein, His-tagged

• Cat.No.: HK3-155H
• Product Overview: Recombinant Human HK3 fused with His tag at C-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 3. Similar to hexokinases 1 and 2, this allosteric enzyme is inhibited by its product glucose-6-phosphate.
• Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
• Molecular Mass: 100kD
• AA Sequence: MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEPRSQEFVIPQEVMLGAGQQLFDFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRSTLISWTKGFRCSGVEGQDVVQLLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRPCEVGLVVDTGTNACYMEEA
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: HK3 hexokinase 3 (white cell) [ Homo sapiens ]
• Official Symbol: HK3
• Synonyms: HK3; hexokinase 3 (white cell); hexokinase-3; HK III; hexokinase type III; ATP:D-hexose 6-phosphotransferase; HXK3; HKIII
• Gene ID: 3101
• mRNA Refseq: NM_002115
• Protein Refseq: NP_002106
• MIM: 142570
• UniProt ID: P52790