Recombinant Human HK3 Protein, His-tagged
| Cat.No. : | HK3-155H |
| Product Overview : | Recombinant Human HK3 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 3. Similar to hexokinases 1 and 2, this allosteric enzyme is inhibited by its product glucose-6-phosphate. |
| Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
| Molecular Mass : | 100kD |
| AA Sequence : | MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEPRSQEFVIPQEVMLGAGQQLFDFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRSTLISWTKGFRCSGVEGQDVVQLLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRPCEVGLVVDTGTNACYMEEA |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | HK3 hexokinase 3 (white cell) [ Homo sapiens ] |
| Official Symbol | HK3 |
| Synonyms | HK3; hexokinase 3 (white cell); hexokinase-3; HK III; hexokinase type III; ATP:D-hexose 6-phosphotransferase; HXK3; HKIII; |
| Gene ID | 3101 |
| mRNA Refseq | NM_002115 |
| Protein Refseq | NP_002106 |
| MIM | 142570 |
| UniProt ID | P52790 |
| ◆ Recombinant Proteins | ||
| HK3-3072H | Recombinant Human HK3 Protein (Met1-Val923), C-His tagged | +Inquiry |
| HK3-1143H | Recombinant Human Hexokinase 3, His-tagged | +Inquiry |
| HK3-4229M | Recombinant Mouse HK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HK3-3073H | Recombinant Human HK3 Protein (Tyr673-Ser903), N-His tagged | +Inquiry |
| HK3-316H | Recombinant Human HK3 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HK3-550HCL | Recombinant Human HK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HK3 Products
Required fields are marked with *
My Review for All HK3 Products
Required fields are marked with *



