Recombinant Human HLA-G protein, His-SUMO-tagged
| Cat.No. : | HLA-G-3036H |
| Product Overview : | Recombinant Human HLA-G protein(P17693)(25-308aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 25-308aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.7 kDa |
| AA Sequence : | GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | HLA-G major histocompatibility complex, class I, G [ Homo sapiens ] |
| Official Symbol | HLA-G |
| Synonyms | HLA-G; major histocompatibility complex, class I, G; HLA G histocompatibility antigen, class I, G; HLA class I histocompatibility antigen, alpha chain G; b2 microglobulin; HLA G antigen; HLA class I molecule; MHC class I antigen G; HLA-G histocompatibility antigen, class I, G; MHC-G; |
| Gene ID | 3135 |
| mRNA Refseq | NM_002127 |
| Protein Refseq | NP_002118 |
| MIM | 142871 |
| UniProt ID | P17693 |
| ◆ Recombinant Proteins | ||
| HLA-G-506R | Recombinant Rhesus macaque HLA-G protein, His-Avi-tagged | +Inquiry |
| HLA-G-504H | Recombinant Human HLA-G protein, His-Avi-tagged, Biotinylated | +Inquiry |
| HLA-G-13828H | Recombinant Human HLA-G, GST-tagged | +Inquiry |
| HLA-G-503C | Recombinant Cynomolgus HLA-G protein, His-Avi-tagged | +Inquiry |
| HLA-G-27H | Recombinant Human HLA-G protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HLA-G-5493HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-G Products
Required fields are marked with *
My Review for All HLA-G Products
Required fields are marked with *
