Recombinant Human HLA-V Protein, GST-tagged
| Cat.No. : | HLA-V-4771H |
| Product Overview : | Human LOC554223 full-length ORF ( AAH51362.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HLA-V (Major Histocompatibility Complex, Class I, V (Pseudogene)) is a Pseudogene. |
| Molecular Mass : | 47.3 kDa |
| AA Sequence : | MDWGGPALGIPHLCRVSLLPLPTCVGSFFLGTHRAAPVLTPIECRVSREANQCSRGPGSKVPTHPPGLRFFPVAEDGVMAPRTLLLLLSGALVLTQTWAGFHSLRYFHTTMSRPGRADPRFLSVGDVDDTQCVRLDSDATSPRMEPRAPWMEQEGPEYWEEETGTAKAKAQFYRVNLRTLSGYYNQSEA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HLA-V major histocompatibility complex, class I, V (pseudogene) [ Homo sapiens (human) ] |
| Official Symbol | HLA-V |
| Synonyms | HLA-V; major histocompatibility complex, class I, V (pseudogene); HLA-75; dJ377H14.4; FLJ17298; FLJ46428; MGC59962; HLA-75 pseudogene; histocompatibility antigen-related |
| Gene ID | 352962 |
| ◆ Recombinant Proteins | ||
| HLA-V-5905HF | Recombinant Full Length Human HLA-V Protein, GST-tagged | +Inquiry |
| HLA-V-4771H | Recombinant Human HLA-V Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-V Products
Required fields are marked with *
My Review for All HLA-V Products
Required fields are marked with *
