"HLF" Related Products

Expand
Expand

Recombinant Human HLF protein, T7/His-tagged

Cat.No.: HLF-209H
Product Overview: Recombinant human HLF cDNA (295aa, which derived from BC036093) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag at C-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKE KKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPS VMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRK RKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVA DLRKELGKCKNILAKYEARHGPLLEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: HLF hepatic leukemia factor [ Homo sapiens ]
Official Symbol: HLF
Synonyms: HLF; hepatic leukemia factor; MGC33822;
Gene ID: 3131
mRNA Refseq: NM_002126
Protein Refseq: NP_002117
MIM: 142385
UniProt ID: Q16534
Chromosome Location: 17q22
Function: DNA binding; double-stranded DNA binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.