Recombinant Human HLF protein, T7/His-tagged
Cat.No. : | HLF-209H |
Product Overview : | Recombinant human HLF cDNA (295aa, which derived from BC036093) fused with T7-His-TEV cleavage site Tag at N-terminal and 11R tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKE KKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPS VMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRK RKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVA DLRKELGKCKNILAKYEARHGPLLEESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | HLF hepatic leukemia factor [ Homo sapiens ] |
Official Symbol | HLF |
Synonyms | HLF; hepatic leukemia factor; MGC33822; |
Gene ID | 3131 |
mRNA Refseq | NM_002126 |
Protein Refseq | NP_002117 |
MIM | 142385 |
UniProt ID | Q16534 |
Chromosome Location | 17q22 |
Function | DNA binding; double-stranded DNA binding; protein dimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
HLF-3618H | Recombinant Human HLF, His-tagged | +Inquiry |
HLF-3633HF | Recombinant Full Length Human HLF Protein, GST-tagged | +Inquiry |
HLF-1924R | Recombinant Rhesus Macaque HLF Protein, His (Fc)-Avi-tagged | +Inquiry |
HLF-209H | Recombinant Human HLF protein, T7/His-tagged | +Inquiry |
HLF-4852H | Recombinant Human HLF Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLF-5490HCL | Recombinant Human HLF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLF Products
Required fields are marked with *
My Review for All HLF Products
Required fields are marked with *
0
Inquiry Basket