Recombinant Human HMCES Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HMCES-2613H |
Product Overview : | C3orf37 MS Standard C13 and N15-labeled recombinant protein (NP_001006109) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Sensor of abasic sites in single-stranded DNA (ssDNA) required to preserve genome integrity by promoting error-free repair of abasic sites. Acts as an enzyme that recognizes and binds abasic sites in ssDNA at replication forks and chemically modifies the lesion by forming a covalent cross-link with DNA: forms a stable thiazolidine linkage between a ring-opened abasic site and the alpha-amino and sulfhydryl substituents of its N-terminal catalytic cysteine residue. The HMCES DNA-protein cross-link is then degraded by the proteasome. Promotes error-free repair of abasic sites by acting as a 'suicide' enzyme that is degraded, thereby protecting abasic sites from translesion synthesis (TLS) polymerases and endonucleases that are error-prone and would generate mutations and double-strand breaks. Has preference for ssDNA, but can also accommodate double-stranded DNA with 3' or 5' overhang (dsDNA), and dsDNA-ssDNA 3' junction. Also involved in class switch recombination (CSR) in B-cells independently of the formation of a DNA-protein cross-link: acts by binding and protecting ssDNA overhangs to promote DNA double-strand break repair through the microhomology-mediated alternative-end-joining (Alt-EJ) pathway. Acts as a protease: mediates autocatalytic processing of its N-terminal methionine in order to expose the catalytic cysteine. |
Molecular Mass : | 40.6 kDa |
AA Sequence : | MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKRPYSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HMCES 5-hydroxymethylcytosine binding, ES cell specific [ Homo sapiens (human) ] |
Official Symbol | HMCES |
Synonyms | HMCES; 5-hydroxymethylcytosine binding, ES cell specific; DC12; SRAPD1; C3orf37; abasic site processing protein HMCES; 5-hydroxymethylcytosine (hmC) binding, ES cell-specific; ES cell-specific 5hmC-binding protein; SOS response associated peptidase domain containing 1; SRAP domain-containing protein 1; UPF0361 protein C3orf37; embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein; peptidase HMCES; putative endonuclease HMCES; putative peptidase SRAPD1 |
Gene ID | 56941 |
mRNA Refseq | NM_001006109 |
Protein Refseq | NP_001006109 |
MIM | 618288 |
UniProt ID | Q96FZ2 |
◆ Recombinant Proteins | ||
HMCES-0030H | Recombinant Human HMCES Protein, GST-Tagged | +Inquiry |
HMCES-4955H | Recombinant Human HMCES Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HMCES-2594HF | Recombinant Full Length Human HMCES Protein, GST-tagged | +Inquiry |
HMCES-5764Z | Recombinant Zebrafish HMCES | +Inquiry |
Hmces-3410M | Recombinant Mouse Hmces Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMCES Products
Required fields are marked with *
My Review for All HMCES Products
Required fields are marked with *
0
Inquiry Basket