Recombinant Human HMCES Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HMCES-4955H
• Product Overview: C3orf37 MS Standard C13 and N15-labeled recombinant protein (NP_064572) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: HMCES (5-Hydroxymethylcytosine Binding, ES Cell Specific) is a Protein Coding gene. Diseases associated with HMCES include Brachydactyly, Type A4 and Arthrogryposis, Distal, Type 6. Gene Ontology (GO) annotations related to this gene include peptidase activity.
• Molecular Mass: 40.6 kDa
• AA Sequence: MCGRTSCHLPRDVLTRACAYQDRRGQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMRWGLVPSWFKESDPSKLQFNTTNCRSDTVMEKRSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGSIGAADSPENWEKVWDNWRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNSRNNTPECLAPVDLVVKKELRASGSSQRMLQWLATKSPKKEDSKTPQKEESDVPQWSSQFLQKSPLPTKRGTAGLLEQWLKREKEEEPVAKRPYSQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HMCES 5-hydroxymethylcytosine binding, ES cell specific [ Homo sapiens (human) ]
• Official Symbol: HMCES
• Synonyms: HMCES; 5-hydroxymethylcytosine binding, ES cell specific; DC12; SRAPD1; C3orf37; abasic site processing protein HMCES; 5-hydroxymethylcytosine (hmC) binding, ES cell-specific; ES cell-specific 5hmC-binding protein; SOS response associated peptidase domain containing 1; SRAP domain-containing protein 1; UPF0361 protein C3orf37; embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein; peptidase HMCES; putative endonuclease HMCES; putative peptidase SRAPD1
• Gene ID: 56941
• mRNA Refseq: NM_020187
• Protein Refseq: NP_064572
• MIM: 618288
• UniProt ID: Q96FZ2