Recombinant Human HMGB2 Protein, GST-tagged

Cat.No. : HMGB2-4869H
Product Overview : Human HMGB2 full-length ORF ( AAH00903.2, 1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. [provided by RefSeq
Molecular Mass : 47.19 kDa
AA Sequence : MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HMGB2 high mobility group box 2 [ Homo sapiens ]
Official Symbol HMGB2
Synonyms HMGB2; high mobility group box 2; high mobility group (nonhistone chromosomal) protein 2 , high mobility group box 2 , HMG2; high mobility group protein B2; HMG-2; high-mobility group box 2; high mobility group protein 2; high-mobility group (nonhistone chromosomal) protein 2; HMG2;
Gene ID 3148
mRNA Refseq NM_001130688
Protein Refseq NP_001124160
MIM 163906
UniProt ID P26583

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMGB2 Products

Required fields are marked with *

My Review for All HMGB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon