Recombinant Human HMGB4 Protein, GST-tagged

• Cat.No.: HMGB4-4873H
• Product Overview: Human HMGB4 full-length ORF (1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HMGB4 (High Mobility Group Box 4) is a Protein Coding gene. GO annotations related to this gene include chromatin binding. An important paralog of this gene is HMGB2.
• Molecular Mass: 48.9 kDa
• AA Sequence: MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPNTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQEPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRGKRVRQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HMGB4 high mobility group box 4 [ Homo sapiens ]
• Official Symbol: HMGB4
• Synonyms: HMGB4; high mobility group box 4; high mobility group protein B4; FLJ40388; HMG2 like; dJ1007G16.5; MGC88128
• Gene ID: 127540
• mRNA Refseq: NM_145205
• Protein Refseq: NP_660206
• UniProt ID: Q8WW32