Recombinant Human HMGB4 Protein, GST-tagged
Cat.No. : | HMGB4-4873H |
Product Overview : | Human HMGB4 full-length ORF (1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HMGB4 (High Mobility Group Box 4) is a Protein Coding gene. GO annotations related to this gene include chromatin binding. An important paralog of this gene is HMGB2. |
Molecular Mass : | 48.9 kDa |
AA Sequence : | MGKEIQLKPKANVSSYVHFLLNYRNKFKEQQPNTYVGFKEFSRKCSEKWRSISKHEKAKYEALAKLDKARYQEEMMNYVGKRKKRRKRDPQEPRRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRGKRVRQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HMGB4 high mobility group box 4 [ Homo sapiens ] |
Official Symbol | HMGB4 |
Synonyms | HMGB4; high mobility group box 4; high mobility group protein B4; FLJ40388; HMG2 like; dJ1007G16.5; MGC88128; |
Gene ID | 127540 |
mRNA Refseq | NM_145205 |
Protein Refseq | NP_660206 |
UniProt ID | Q8WW32 |
◆ Recombinant Proteins | ||
HMGB4-13844H | Recombinant Human HMGB4, GST-tagged | +Inquiry |
HMGB4-3673H | Recombinant Human HMGB4 Protein (Asn25-Arg167), N-His tagged | +Inquiry |
HMGB4-4873H | Recombinant Human HMGB4 Protein, GST-tagged | +Inquiry |
Hmgb4-1628R | Recombinant Rat Hmgb4 Protein, His-tagged | +Inquiry |
HMGB4-3646HF | Recombinant Full Length Human HMGB4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGB4-5476HCL | Recombinant Human HMGB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGB4 Products
Required fields are marked with *
My Review for All HMGB4 Products
Required fields are marked with *
0
Inquiry Basket