Recombinant Human HMGCR protein, His-tagged
| Cat.No. : | HMGCR-3039H |
| Product Overview : | Recombinant Human HMGCR protein(P04035)(588-887aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 588-887aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36 kDa |
| AA Sequence : | MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKT |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | HMGCR 3-hydroxy-3-methylglutaryl-CoA reductase [ Homo sapiens ] |
| Official Symbol | HMGCR |
| Synonyms | HMGCR; 3-hydroxy-3-methylglutaryl-CoA reductase; 3 hydroxy 3 methylglutaryl Coenzyme A reductase; 3-hydroxy-3-methylglutaryl-Coenzyme A reductase; 3 hydroxy 3 methylglutaryl CoA reductase (NADPH); hydroxymethylglutaryl CoA reductase; HMG-CoA reductase; hydroxymethylglutaryl-CoA reductase; 3-hydroxy-3-methylglutaryl CoA reductase (NADPH); LDLCQ3; |
| Gene ID | 3156 |
| mRNA Refseq | NM_000859 |
| Protein Refseq | NP_000850 |
| UniProt ID | P04035 |
| ◆ Recombinant Proteins | ||
| HMGCR-263H | Active Recombinant Human HMGCR protein, His-tagged | +Inquiry |
| HMGCR-2563H | Recombinant Human HMGCR Protein (Glu441-Asn875), N-SUMO tagged | +Inquiry |
| HMGCR-2523R | Recombinant Rat HMGCR Protein, His (Fc)-Avi-tagged | +Inquiry |
| HMGCR-231H | Recombinant Human HMGCR | +Inquiry |
| HMGCR-4241M | Recombinant Mouse HMGCR Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HMGCR-802HCL | Recombinant Human HMGCR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGCR Products
Required fields are marked with *
My Review for All HMGCR Products
Required fields are marked with *
