Recombinant Human HNRNPA0 protein, GST-tagged
| Cat.No. : | HNRNPA0-13864H |
| Product Overview : | Recombinant Human HNRNPA0 protein(1-305 aa), fused with GST tag, was expressed in E.coli. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-305 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRGFGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGGRDQNGLSKGGGGGYNSYGGYGGGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSSWGGRSNSGPYRGGYGGGGGYGGSSF |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | HNRNPA0 heterogeneous nuclear ribonucleoprotein A0 [ Homo sapiens ] |
| Official Symbol | HNRNPA0 |
| Synonyms | HNRPA0 |
| Gene ID | 10949 |
| mRNA Refseq | NM_006805.3 |
| Protein Refseq | NP_006796.1 |
| MIM | 609409 |
| UniProt ID | Q13151 |
| ◆ Recombinant Proteins | ||
| HNRNPA0-13864H | Recombinant Human HNRNPA0 protein, GST-tagged | +Inquiry |
| Hnrnpa0-3418M | Recombinant Mouse Hnrnpa0 Protein, Myc/DDK-tagged | +Inquiry |
| HNRNPA0-2117R | Recombinant Rhesus monkey HNRNPA0 Protein, His-tagged | +Inquiry |
| HNRNPA0-7755M | Recombinant Mouse HNRNPA0 Protein | +Inquiry |
| HNRNPA0-3678HF | Recombinant Full Length Human HNRNPA0 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNRNPA0-5454HCL | Recombinant Human HNRNPA0 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPA0 Products
Required fields are marked with *
My Review for All HNRNPA0 Products
Required fields are marked with *



