Recombinant Human HNRNPC, His-tagged
| Cat.No. : | HNRNPC-31724TH |
| Product Overview : | Recombinant full length Human hnRNP C1 + C2 (amino acids 1-293) with an N terminal His tag; 313aa, 34.5kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 293 amino acids |
| Description : | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene. |
| Conjugation : | HIS |
| Molecular Weight : | 34.500kDa inclusive of tags |
| Form : | Liquid |
| Purity : | by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS |
| Sequence Similarities : | Belongs to the RRM HNRPC family. RALY subfamily.Contains 1 RRM (RNA recognition motif) domain. |
| Gene Name | HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) [ Homo sapiens ] |
| Official Symbol | HNRNPC |
| Synonyms | HNRNPC; heterogeneous nuclear ribonucleoprotein C (C1/C2); HNRPC; heterogeneous nuclear ribonucleoproteins C1/C2; hnRNPC; |
| Gene ID | 3183 |
| mRNA Refseq | NM_001077442 |
| Protein Refseq | NP_001070910 |
| MIM | 164020 |
| Uniprot ID | P07910 |
| Chromosome Location | 14q11 |
| Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Regulation of Telomerase, organism-specific biosystem; Spliceosome, organism-specific biosystem; |
| Function | RNA binding; identical protein binding; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| HNRNPC-4901H | Recombinant Human HNRNPC Protein, GST-tagged | +Inquiry |
| HNRNPC-1942R | Recombinant Rhesus Macaque HNRNPC Protein, His (Fc)-Avi-tagged | +Inquiry |
| HNRNPC-3679HF | Recombinant Full Length Human HNRNPC Protein, GST-tagged | +Inquiry |
| HNRNPC-13868H | Recombinant Human HNRNPC, GST-tagged | +Inquiry |
| HNRNPC-2121R | Recombinant Rhesus monkey HNRNPC Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNRNPC-5449HCL | Recombinant Human HNRNPC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPC Products
Required fields are marked with *
My Review for All HNRNPC Products
Required fields are marked with *




