Recombinant Human HNRNPC Protein, GST-tagged
| Cat.No. : | HNRNPC-4901H |
| Product Overview : | Human HNRNPC full-length ORF ( AAH89438.1, 1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene. [provided by RefSeq |
| Molecular Mass : | 54.2 kDa |
| AA Sequence : | MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) [ Homo sapiens ] |
| Official Symbol | HNRNPC |
| Synonyms | HNRNPC; heterogeneous nuclear ribonucleoprotein C (C1/C2); HNRPC; heterogeneous nuclear ribonucleoproteins C1/C2; hnRNPC; hnRNP C1/C2; nuclear ribonucleoprotein particle C1 protein; nuclear ribonucleoprotein particle C2 protein; C1; C2; HNRNP; SNRPC; MGC104306; MGC105117; MGC117353; MGC131677; |
| Gene ID | 3183 |
| mRNA Refseq | NM_001077442 |
| Protein Refseq | NP_001070910 |
| MIM | 164020 |
| UniProt ID | P07910 |
| ◆ Recombinant Proteins | ||
| HNRNPC-562HFL | Recombinant Full Length Human HNRNPC Protein, C-Flag-tagged | +Inquiry |
| Hnrnpc-1148M | Recombinant Mouse Hnrnpc Protein, MYC/DDK-tagged | +Inquiry |
| HNRNPC-2121R | Recombinant Rhesus monkey HNRNPC Protein, His-tagged | +Inquiry |
| HNRNPC-4901H | Recombinant Human HNRNPC Protein, GST-tagged | +Inquiry |
| HNRNPC-4259M | Recombinant Mouse HNRNPC Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNRNPC-5449HCL | Recombinant Human HNRNPC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPC Products
Required fields are marked with *
My Review for All HNRNPC Products
Required fields are marked with *
