Recombinant Human HNRNPC Protein, GST-tagged

Cat.No. : HNRNPC-4901H
Product Overview : Human HNRNPC full-length ORF ( AAH89438.1, 1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene. [provided by RefSeq
Molecular Mass : 54.2 kDa
AA Sequence : MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSANGEDDS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) [ Homo sapiens ]
Official Symbol HNRNPC
Synonyms HNRNPC; heterogeneous nuclear ribonucleoprotein C (C1/C2); HNRPC; heterogeneous nuclear ribonucleoproteins C1/C2; hnRNPC; hnRNP C1/C2; nuclear ribonucleoprotein particle C1 protein; nuclear ribonucleoprotein particle C2 protein; C1; C2; HNRNP; SNRPC; MGC104306; MGC105117; MGC117353; MGC131677;
Gene ID 3183
mRNA Refseq NM_001077442
Protein Refseq NP_001070910
MIM 164020
UniProt ID P07910

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HNRNPC Products

Required fields are marked with *

My Review for All HNRNPC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon