Recombinant Human HNRNPC, His-tagged
Cat.No. : | HNRNPC-31751TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 84-293 of Human hnRNP C1 + C2 with N terminal His tag;Predicted MWt 24 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 84-293 a.a. |
Description : | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene can act as a tetramer and is involved in the assembly of 40S hnRNP particles. Multiple transcript variants encoding at least two different isoforms have been described for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 117 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRM YSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFN SKSGQRGSSKSGKLKGDDLQAIKKELTQIKQKVDSLLE NLEKIEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVK MESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEA EEGEDDRDSANGEDDS |
Sequence Similarities : | Belongs to the RRM HNRPC family. RALY subfamily.Contains 1 RRM (RNA recognition motif) domain. |
Gene Name | HNRNPC heterogeneous nuclear ribonucleoprotein C (C1/C2) [ Homo sapiens ] |
Official Symbol | HNRNPC |
Synonyms | HNRNPC; heterogeneous nuclear ribonucleoprotein C (C1/C2); HNRPC; heterogeneous nuclear ribonucleoproteins C1/C2; hnRNPC; |
Gene ID | 3183 |
mRNA Refseq | NM_001077442 |
Protein Refseq | NP_001070910 |
MIM | 164020 |
Uniprot ID | P07910 |
Chromosome Location | 14q11 |
Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Regulation of Telomerase, organism-specific biosystem; Spliceosome, organism-specific biosystem; |
Function | RNA binding; identical protein binding; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
HNRNPC-5026H | Recombinant Human Heterogeneous Nuclear Ribonucleoprotein C, His-tagged | +Inquiry |
HNRNPC-4259M | Recombinant Mouse HNRNPC Protein, His (Fc)-Avi-tagged | +Inquiry |
HNRNPC-31724TH | Recombinant Human HNRNPC, His-tagged | +Inquiry |
HNRNPC-7760M | Recombinant Mouse HNRNPC Protein | +Inquiry |
HNRNPC-1942R | Recombinant Rhesus Macaque HNRNPC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPC-5449HCL | Recombinant Human HNRNPC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPC Products
Required fields are marked with *
My Review for All HNRNPC Products
Required fields are marked with *
0
Inquiry Basket